Name | O_BomoBR100875_complete:A_BomoBR_DN30712_c1_g2_i2 |
Scaffold_id | Bomo_Chr6 |
NCBI non-redundant (nr) | probable_2-oxoglutarate_dehydrogenase_E1_component_DHKTD1_homolog,_mitochondrial_isoform_X1_[Bombyx_mori] |
Ontology |
GO:0004591 |
F |
oxoglutarate dehydrogenase (succinyl-transferring) activity |
GO:0005739 |
C |
mitochondrion |
GO:0005829 |
C |
cytosol |
GO:0006091 |
P |
generation of precursor metabolites and energy |
GO:0006096 |
P |
glycolytic process |
GO:0006099 |
P |
tricarboxylic acid cycle |
GO:0008152 |
P |
metabolic process |
GO:0016491 |
F |
oxidoreductase activity |
GO:0016624 |
F |
oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor |
GO:0030976 |
F |
thiamine pyrophosphate binding |
GO:0031966 |
C |
mitochondrial membrane |
GO:0045252 |
C |
oxoglutarate dehydrogenase complex |
GO:0055114 |
P |
obsolete oxidation-reduction process |
|
RNA-seq Entry | A_BomoBR_DN30712_c1_g2_i2 |
Sequence (Amino Acid) | MLCFSKVRVSRLRCKVDRLYDRVLYHSGAGVFGHRPTIADEYEIPEDIISKRYKNCRAQQ
LVNAYRTYGHLKATIDNVDYRNESRYCIFQNKVFSLRLLNLRA
*(33 a.a.) |