SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoBR100776_complete:A_BomoBR_DN30717_c3_g3_i2
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)
vascular_endothelial_growth_factor_receptor_1_isoform_X3_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0001553 P luteinization
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004714 F transmembrane receptor protein tyrosine kinase activity
GO:0005018 F platelet-derived growth factor alpha-receptor activity
GO:0005021 F vascular endothelial growth factor-activated receptor activity
GO:0005524 F ATP binding
GO:0005575 C cellular_component
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006468 P protein phosphorylation
GO:0006935 P chemotaxis
GO:0007169 P transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007204 P positive regulation of cytosolic calcium ion concentration
GO:0007275 P multicellular organism development
GO:0008284 P positive regulation of cell population proliferation
GO:0009725 P response to hormone
GO:0010033 P response to organic substance
GO:0010035 P response to inorganic substance
GO:0010544 P negative regulation of platelet activation
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0030335 P positive regulation of cell migration
GO:0032355 P response to estradiol
GO:0034097 P response to cytokine
GO:0035790 P platelet-derived growth factor receptor-alpha signaling pathway
GO:0038084 P vascular endothelial growth factor signaling pathway
GO:0042060 P wound healing
GO:0042063 P gliogenesis
GO:0042803 F protein homodimerization activity
GO:0043548 F phosphatidylinositol 3-kinase binding
GO:0043552 P positive regulation of phosphatidylinositol 3-kinase activity
GO:0043627 P response to estrogen
GO:0044344 P cellular response to fibroblast growth factor stimulus
GO:0045740 P positive regulation of DNA replication
GO:0046777 P protein autophosphorylation
GO:0046983 F protein dimerization activity
GO:0048008 P platelet-derived growth factor receptor signaling pathway
GO:0048015 P phosphatidylinositol-mediated signaling
GO:0048146 P positive regulation of fibroblast proliferation
GO:0048557 P embryonic digestive tract morphogenesis
GO:0048701 P embryonic cranial skeleton morphogenesis
GO:0048704 P embryonic skeletal system morphogenesis
GO:0048839 P inner ear development
GO:0055003 P cardiac myofibril assembly
GO:0055093 P response to hyperoxia
GO:0060326 P cell chemotaxis
GO:0061298 P retina vasculature development in camera-type eye
GO:0070374 P positive regulation of ERK1 and ERK2 cascade
GO:0070527 P platelet aggregation
GO:0071347 P cellular response to interleukin-1
GO:0072277 P metanephric glomerular capillary formation
GO:1904404 P response to formaldehyde
GO:2000739 P regulation of mesenchymal stem cell differentiation
RNA-seq EntryA_BomoBR_DN30717_c3_g3_i2
Sequence
(Amino Acid)
MHAVGIKVTKMTSFNVLLFICVTGLISVTTTNADNCTDFHPNGPKITPCRSEFILHKGQN
FSLTCRGKNPLEFKQQETPEELPKNKPIKTMRQTSDSEYPFETIINIYNVDEYAIGYYAC
FDDVKTNFTLNNLIEEPRNTENASFIYIYVEGSDSLIAPMREIVVPRDCSKIVIECRPTT
PDVNVTLSSILKNLQNQRLQVDINNF
*(68 a.a.)

- SilkBase 1999-2023 -