SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoBR100506_5prime_partial:A_BomoBR_DN30708_c0_g3_i6
Scaffold_idBomo_Chr16
NCBI non-redundant
(nr)		uncharacterized_protein_LOC101736053_[Bombyx_mori]
Ontology
GO:0001843 P neural tube closure
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005814 C centriole
GO:0005815 C microtubule organizing center
GO:0005856 C cytoskeleton
GO:0005929 C cilium
GO:0007368 P determination of left/right symmetry
GO:0008589 P regulation of smoothened signaling pathway
GO:0010669 P epithelial structure maintenance
GO:0016020 C membrane
GO:0030030 P cell projection organization
GO:0035058 P non-motile cilium assembly
GO:0035869 C ciliary transition zone
GO:0036038 C MKS complex
GO:0036064 C ciliary basal body
GO:0042384 P cilium assembly
GO:0042733 P embryonic digit morphogenesis
GO:0042995 C cell projection
GO:0048706 P embryonic skeletal system development
GO:0048754 P branching morphogenesis of an epithelial tube
GO:0060122 P inner ear receptor cell stereocilium organization
GO:0060271 P cilium assembly
GO:0060322 P head development
GO:0060828 P regulation of canonical Wnt signaling pathway
GO:0061009 P common bile duct development
GO:1901620 P regulation of smoothened signaling pathway involved in dorsal/ventral neural tube patterning
GO:1903887 P motile cilium assembly
GO:1990403 P embryonic brain development
GO:2000095 P regulation of Wnt signaling pathway, planar cell polarity pathway
RNA-seq EntryA_BomoBR_DN30708_c0_g3_i6
Sequence
(Amino Acid)
AGFEPATPLCSDHVTYHYTRGPLIFRLYSKKFQLTRLQKRWNKRNKNLIYFSGPPVDFRN
IYLSFEIISVEDFQLQYLYIQYNVKLGQVYQCDRGSFGRTHKKFPDDSKANHYCEIGHAV
DLKLSCLASIEPPPIQIVFEVQSAEYPVIFRTEGYGTLTVPVTAGQFTATLTTLMPEDVN
YAEGATRRFFIGGRHLIKDPVLLDHSQSTDSEYSNQEAGTVHLRWSIRTEVGPGLRTVPV
PAVGTASSAVLHGAEVAVMRYRLAKAKLQAATKEEEPAEGNDSANKESTESDDSPIKKST
QEDNTTGKEKKKET
*(104 a.a.)

- SilkBase 1999-2023 -