EntryView

ORF from Assembled RNA_seq Entry

Name

O_BomoBR100188_internal:A_BomoBR_DN30716_c0_g1_i35

Scaffold_id

NCBI non-redundant
(nr)

microtubule-associated_protein_futsch_[Bombyx_mori]

Ontology

GO:0000226	P	microtubule cytoskeleton organization
GO:0001552	P	ovarian follicle atresia
GO:0005198	F	structural molecule activity
GO:0005200	F	structural constituent of cytoskeleton
GO:0005634	C	nucleus
GO:0005737	C	cytoplasm
GO:0005739	C	mitochondrion
GO:0005882	C	intermediate filament
GO:0005883	C	neurofilament
GO:0007409	P	axonogenesis
GO:0007420	P	brain development
GO:0008017	F	microtubule binding
GO:0015643	F	toxic substance binding
GO:0019894	F	kinesin binding
GO:0019901	F	protein kinase binding
GO:0021510	P	spinal cord development
GO:0021766	P	hippocampus development
GO:0021987	P	cerebral cortex development
GO:0030031	P	cell projection assembly
GO:0030424	C	axon
GO:0030674	F	protein-macromolecule adaptor activity
GO:0031103	P	axon regeneration
GO:0031175	P	neuron projection development
GO:0033693	P	neurofilament bundle assembly
GO:0034599	P	cellular response to oxidative stress
GO:0042220	P	response to cocaine
GO:0043204	C	perikaryon
GO:0043209	C	myelin sheath
GO:0045104	P	intermediate filament cytoskeleton organization
GO:0045110	P	intermediate filament bundle assembly
GO:0045502	F	dynein complex binding
GO:0046982	F	protein heterodimerization activity
GO:0048936	P	peripheral nervous system neuron axonogenesis
GO:0060052	P	neurofilament cytoskeleton organization
GO:0061564	P	axon development
GO:0071392	P	cellular response to estradiol stimulus
GO:0097418	C	neurofibrillary tangle
GO:0097481	C	postsynaptic density
GO:1902513	P	regulation of organelle transport along microtubule
GO:1903935	P	response to sodium arsenite
GO:1903937	P	response to acrylamide

RNA-seq Entry

Sequence
(Amino Acid)

EKALSPVKDDEKATSPVVDDEKAPSPIKEDEKAPSPIEVVEEEPMLITNDQKAPSPIKEN
AKAPSPIKDVEKAPSPIKKDEKAPSPVEVVEEEPMLITDDQKAPSPIK
(35 a.a.)

- SilkBase 1999-2023 -