SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoBR100184_internal:A_BomoBR_DN30716_c0_g1_i32
Scaffold_idBomo_Chr21
NCBI non-redundant
(nr)
microtubule-associated_protein_futsch_[Bombyx_mori]
Ontology
GO:0000226 P microtubule cytoskeleton organization
GO:0001552 P ovarian follicle atresia
GO:0005198 F structural molecule activity
GO:0005200 F structural constituent of cytoskeleton
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005882 C intermediate filament
GO:0005883 C neurofilament
GO:0007409 P axonogenesis
GO:0007420 P brain development
GO:0008017 F microtubule binding
GO:0015643 F toxic substance binding
GO:0019894 F kinesin binding
GO:0019901 F protein kinase binding
GO:0021510 P spinal cord development
GO:0021766 P hippocampus development
GO:0021987 P cerebral cortex development
GO:0030031 P cell projection assembly
GO:0030424 C axon
GO:0030674 F protein-macromolecule adaptor activity
GO:0031103 P axon regeneration
GO:0031175 P neuron projection development
GO:0033693 P neurofilament bundle assembly
GO:0034599 P cellular response to oxidative stress
GO:0042220 P response to cocaine
GO:0043204 C perikaryon
GO:0043209 C myelin sheath
GO:0045104 P intermediate filament cytoskeleton organization
GO:0045110 P intermediate filament bundle assembly
GO:0045502 F dynein complex binding
GO:0046982 F protein heterodimerization activity
GO:0048936 P peripheral nervous system neuron axonogenesis
GO:0060052 P neurofilament cytoskeleton organization
GO:0061564 P axon development
GO:0071392 P cellular response to estradiol stimulus
GO:0097418 C neurofibrillary tangle
GO:0097481 C postsynaptic density
GO:1902513 P regulation of organelle transport along microtubule
GO:1903935 P response to sodium arsenite
GO:1903937 P response to acrylamide
RNA-seq EntryA_BomoBR_DN30716_c0_g1_i32
Sequence
(Amino Acid)
PIHIKDDEKASRLITEDEKVASLFEVVNKEPIHITGDQKAPRPVEDDKKAPSTIKEVERT
PSPIKEDEKAQSPIKEDEKVPSSIEENEKAPGHVKDAVKTPRLIKDDDKTQPPIEEEQKT
PTLIETLKKELTPIKEGEKGSVPIKDDQKATSLTEEVEKAPKPIDLDEKVTSLTHLDDIK
IQSFDQTEEERTMKKLVESSFTSAVTTTTSEDVITHKDLVSTFLDMERQLISSTKTTVSS
QLEQIIPSYTEIKEKEPVPIKEDEKAPSPIKQDVKAPTSVKDDEKAPSPIKDDEKAPSPV
KDVEKAPSPV
(102 a.a.)

- SilkBase 1999-2023 -