SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoBR100011_complete:A_BomoBR_DN30705_c5_g1_i8
Scaffold_idBomo_Chr20
NCBI non-redundant
(nr)		ovary_C/EBPg_transcription_factor_[Bombyx_mori]
Ontology
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001889 P liver development
GO:0003677 F DNA binding
GO:0003690 F double-stranded DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006366 P transcription by RNA polymerase II
GO:0006955 P immune response
GO:0008134 F transcription factor binding
GO:0016071 P mRNA metabolic process
GO:0030183 P B cell differentiation
GO:0042267 P natural killer cell mediated cytotoxicity
GO:0042803 F protein homodimerization activity
GO:0043353 P enucleate erythrocyte differentiation
GO:0043388 P positive regulation of DNA binding
GO:0043433 P negative regulation of DNA-binding transcription factor activity
GO:0043565 F sequence-specific DNA binding
GO:0044377 F RNA polymerase II cis-regulatory region sequence-specific DNA binding, bending
GO:0045078 P positive regulation of interferon-gamma production
GO:0045739 P positive regulation of DNA repair
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046982 F protein heterodimerization activity
GO:0051091 P positive regulation of DNA-binding transcription factor activity
RNA-seq EntryA_BomoBR_DN30705_c5_g1_i8
Sequence
(Amino Acid)
MLLEDNFYDMPPVKRGKRGVSDADDEDDDYRKRRNRNNEAVKKSRFKSKQRTQETFSRVS
KLKAENQVLEEKVKTLSKQLQFLKDLFFAQAKKDTTELEGIDLNKLFEDLPDDRDTNDK
*(39 a.a.)

- SilkBase 1999-2023 -