SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG3584_internal:A_BomoASG_c16466_g1_i1
Scaffold_idBomo_Chr23
NCBI non-redundant
(nr)		toll-like_receptor_6_[Bombyx_mori]
Ontology
GO:0005509 F calcium ion binding
GO:0005576 C extracellular region
GO:0005578 C extracellular matrix
GO:0005615 C extracellular space
GO:0005739 C mitochondrion
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007411 P axon guidance
GO:0008201 F heparin binding
GO:0008285 P negative regulation of cell population proliferation
GO:0009887 P animal organ morphogenesis
GO:0010629 P negative regulation of gene expression
GO:0021834 P chemorepulsion involved in embryonic olfactory bulb interneuron precursor migration
GO:0030154 P cell differentiation
GO:0030308 P negative regulation of cell growth
GO:0032870 P cellular response to hormone stimulus
GO:0035385 P Roundabout signaling pathway
GO:0048495 F Roundabout binding
GO:0048846 P axon extension involved in axon guidance
GO:0050770 P regulation of axonogenesis
GO:0050919 P negative chemotaxis
GO:0051414 P response to cortisol
GO:0061364 P apoptotic process involved in luteolysis
GO:0070100 P negative regulation of chemokine-mediated signaling pathway
RNA-seq EntryA_BomoASG_c16466_g1_i1
Sequence
(Amino Acid)
VMDLESIYCKLLYNRERTYIPLIEAESSQFLCTYKTHCFTLCQCCDFDACDCEMTCPSNC
TCYHDQPWSANIVDCSAAGYSEIPNSIPMDATELYLDGNNFGGLTSHAFIGRKNLKILYA
NNSNI
(40 a.a.)

- SilkBase 1999-2023 -