SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG3379_3prime_partial:A_BomoASG_c15777_g1_i1
Scaffold_idBomo_Chr23
NCBI non-redundant
(nr)		LOW_QUALITY_PROTEIN:_toll-like_receptor_6_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0002224 P toll-like receptor signaling pathway
GO:0002237 P response to molecule of bacterial origin
GO:0002376 P immune system process
GO:0002755 P MyD88-dependent toll-like receptor signaling pathway
GO:0004888 F transmembrane signaling receptor activity
GO:0005149 F interleukin-1 receptor binding
GO:0005576 C extracellular region
GO:0005737 C cytoplasm
GO:0005764 C lysosome
GO:0005768 C endosome
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005886 C plasma membrane
GO:0006954 P inflammatory response
GO:0007165 P signal transduction
GO:0007252 P I-kappaB phosphorylation
GO:0007409 P axonogenesis
GO:0010008 C endosome membrane
GO:0010628 P positive regulation of gene expression
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016303 F 1-phosphatidylinositol-3-kinase activity
GO:0016323 C basolateral plasma membrane
GO:0016324 C apical plasma membrane
GO:0030277 P maintenance of gastrointestinal epithelium
GO:0031410 C cytoplasmic vesicle
GO:0032009 C early phagosome
GO:0032088 P negative regulation of NF-kappaB transcription factor activity
GO:0032640 P tumor necrosis factor production
GO:0032715 P negative regulation of interleukin-6 production
GO:0032717 P negative regulation of interleukin-8 production
GO:0032722 P positive regulation of chemokine production
GO:0032725 P positive regulation of granulocyte macrophage colony-stimulating factor production
GO:0032728 P positive regulation of interferon-beta production
GO:0032733 P positive regulation of interleukin-10 production
GO:0032735 P positive regulation of interleukin-12 production
GO:0032741 P positive regulation of interleukin-18 production
GO:0032755 P positive regulation of interleukin-6 production
GO:0032757 P positive regulation of interleukin-8 production
GO:0032760 P positive regulation of tumor necrosis factor production
GO:0034122 P negative regulation of toll-like receptor signaling pathway
GO:0034123 P positive regulation of toll-like receptor signaling pathway
GO:0034162 P toll-like receptor 9 signaling pathway
GO:0035197 F siRNA binding
GO:0036020 C endolysosome membrane
GO:0036092 P phosphatidylinositol-3-phosphate biosynthetic process
GO:0042346 P positive regulation of NIK/NF-kappaB signaling
GO:0042742 P defense response to bacterium
GO:0043123 P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043507 P positive regulation of JUN kinase activity
GO:0045078 P positive regulation of interferon-gamma production
GO:0045087 P innate immune response
GO:0045335 C phagocytic vesicle
GO:0045356 P positive regulation of interferon-alpha production
GO:0045359 P positive regulation of interferon-beta production
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046330 P positive regulation of JNK cascade
GO:0050707 P regulation of cytokine production
GO:0050729 P positive regulation of inflammatory response
GO:0050829 P defense response to Gram-negative bacterium
GO:0051092 P positive regulation of NF-kappaB transcription factor activity
GO:0051770 P positive regulation of nitric-oxide synthase biosynthetic process
GO:1901895 P negative regulation of ATPase-coupled calcium transmembrane transporter activity
RNA-seq EntryA_BomoASG_c15777_g1_i1
Sequence
(Amino Acid)
MDGNEITKFDGIFSTLNSLVWLNMSANKLSYFDFRSFPESLEWLDLHKNSISTYKNDDTH
SNVNIKLLDLSYNNITEITVTSIPNSVEKLYLNDNNIQNIQVGSFSKLQRL
(36 a.a.)

- SilkBase 1999-2023 -