SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG3219_5prime_partial:A_BomoASG_c15290_g1_i1
Scaffold_idBomo_Chr27
NCBI non-redundant
(nr)		dual_specificity_tyrosine-phosphorylation-regulated_kinase_2-like_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000281 P mitotic cytokinesis
GO:0000793 C condensed chromosome
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004712 F protein serine/threonine/tyrosine kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005938 C cell cortex
GO:0006468 P protein phosphorylation
GO:0007017 P microtubule-based process
GO:0007275 P multicellular organism development
GO:0009792 P embryo development ending in birth or egg hatching
GO:0009880 P embryonic pattern specification
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018105 P peptidyl-serine phosphorylation
GO:0018107 P peptidyl-threonine phosphorylation
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0032436 P positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0043186 C P granule
GO:0045167 P asymmetric protein localization involved in cell fate determination
GO:0045732 P positive regulation of protein catabolic process
GO:0046777 P protein autophosphorylation
GO:0072686 C mitotic spindle
GO:1903864 P P granule disassembly
RNA-seq EntryA_BomoASG_c15290_g1_i1
Sequence
(Amino Acid)
LGMPPPKLIEQGKRSKNFISSKGLPRYCTATTLADGTTVLSGGMSRRGKPRGPPGSKSFV
TALKGCQDKFFIDFIRRCLEWDPEKRLTPAAALRHAWLRRRLPRAPHDDEPNHVSIAHHA
KRLAHPNCTDK
*(43 a.a.)

- SilkBase 1999-2023 -