SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG3163_internal:A_BomoASG_c15112_g1_i1
Scaffold_idBomo_Chr22
NCBI non-redundant
(nr)		dedicator_of_cytokinesis_protein_3_isoform_X1_[Bombyx_mori]
Ontology
GO:0005085 F guanyl-nucleotide exchange factor activity
GO:0005096 F GTPase activator activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0007264 P small GTPase mediated signal transduction
GO:0016020 C membrane
GO:0017124 F SH3 domain binding
GO:0030165 F PDZ domain binding
GO:0030971 F receptor tyrosine kinase binding
GO:0032420 C stereocilium
GO:0032421 C stereocilium bundle
GO:0042995 C cell projection
GO:0043547 P positive regulation of GTPase activity
GO:0048365 F small GTPase binding
GO:0060326 P cell chemotaxis
GO:1904694 P negative regulation of vascular associated smooth muscle contraction
GO:1904754 P positive regulation of vascular associated smooth muscle cell migration
RNA-seq EntryA_BomoASG_c15112_g1_i1
Sequence
(Amino Acid)
NRKLGLELVPRRGAEAVEPEDISLVELYRVHVESAERAAAWRGTLRRAGGSGSSFSSGTL
TNNSNNAPPTTTAQSHHLMCSMRDFGHTAGGDEAELLLWLHDARRSQPLSERFRIRIARD
(39 a.a.)

- SilkBase 1999-2023 -