SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG2971_internal:A_BomoASG_c14806_g1_i1
Scaffold_idBomo_Chr8
NCBI non-redundant
(nr)		protein_deltex_[Bombyx_mori]
Ontology
GO:0005112 F Notch binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006897 P endocytosis
GO:0007219 P Notch signaling pathway
GO:0007220 P Notch receptor processing
GO:0008270 F zinc ion binding
GO:0008593 P regulation of Notch signaling pathway
GO:0016055 P Wnt signaling pathway
GO:0016348 P imaginal disc-derived leg joint morphogenesis
GO:0016567 P protein ubiquitination
GO:0016874 F ligase activity
GO:0017124 F SH3 domain binding
GO:0035220 P wing disc development
GO:0045746 P negative regulation of Notch signaling pathway
GO:0045747 P positive regulation of Notch signaling pathway
GO:0046872 F metal ion binding
GO:0061630 F ubiquitin protein ligase activity
RNA-seq EntryA_BomoASG_c14806_g1_i1
Sequence
(Amino Acid)
RCGHALHAACLARRLRALARAGEPLHVECGACGHSYGAPGPPPRAAPRPPLCSGAQPRGS
MSWRLQPVSLPQFEYSSSILVTYNFQSGTQGAAHPAPGSPYYAVGFPRHSLLPDTQLG
(38 a.a.)

- SilkBase 1999-2023 -