SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG2926_internal:A_BomoASG_c14700_g1_i1
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)		sterol_regulatory_element-binding_protein_cleavage-activating_protein_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0001666 P response to hypoxia
GO:0005515 F protein binding
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005794 C Golgi apparatus
GO:0006629 P lipid metabolic process
GO:0007568 P aging
GO:0008202 P steroid metabolic process
GO:0008203 P cholesterol metabolic process
GO:0012507 C ER to Golgi transport vesicle membrane
GO:0015485 F cholesterol binding
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0019217 P regulation of fatty acid metabolic process
GO:0031410 C cytoplasmic vesicle
GO:0032403 F protein-containing complex binding
GO:0032868 P response to insulin
GO:0032933 P SREBP signaling pathway
GO:0042304 P regulation of fatty acid biosynthetic process
GO:0043231 C intracellular membrane-bounded organelle
GO:0043234 C protein-containing complex
GO:0045540 P regulation of cholesterol biosynthetic process
GO:0045541 P negative regulation of cholesterol biosynthetic process
GO:0045716 P obsolete positive regulation of low-density lipoprotein particle receptor biosynthetic process
GO:0051082 F unfolded protein binding
RNA-seq EntryA_BomoASG_c14700_g1_i1
Sequence
(Amino Acid)
SITKNLLTEITIFTVSFFTFVPFIQEFSIFMIVSLLSDYFIQILFFATVLGIDVRHIEYL
QDKNNKLHLKEYFSMHNALNWRYNKSYTDEFNFSPQPMTKSKSHPRLIGLAQNS
(37 a.a.)

- SilkBase 1999-2023 -