SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG2606_3prime_partial:A_BomoASG_c13595_g1_i1
Scaffold_idBomo_Chr6
NCBI non-redundant
(nr)		cadherin-99C_[Bombyx_mori]
Ontology
GO:0001750 C photoreceptor outer segment
GO:0001964 P startle response
GO:0002009 P morphogenesis of an epithelium
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005615 C extracellular space
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0007015 P actin filament organization
GO:0007155 P cell adhesion
GO:0007156 P homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007601 P visual perception
GO:0007605 P sensory perception of sound
GO:0007626 P locomotory behavior
GO:0007628 P adult walking behavior
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0032403 F protein-containing complex binding
GO:0032420 C stereocilium
GO:0032421 C stereocilium bundle
GO:0035058 P non-motile cilium assembly
GO:0035264 P multicellular organism growth
GO:0042491 P inner ear auditory receptor cell differentiation
GO:0045202 C synapse
GO:0045494 P photoreceptor cell maintenance
GO:0047485 F protein N-terminus binding
GO:0048839 P inner ear development
GO:0050910 P detection of mechanical stimulus involved in sensory perception of sound
GO:0050953 P sensory perception of light stimulus
GO:0050957 P equilibrioception
GO:0050973 P detection of mechanical stimulus involved in equilibrioception
GO:0051017 P actin filament bundle assembly
GO:0051592 P response to calcium ion
GO:0060013 P righting reflex
GO:0060088 P auditory receptor cell stereocilium organization
GO:0060122 P inner ear receptor cell stereocilium organization
GO:0070062 C extracellular exosome
RNA-seq EntryA_BomoASG_c13595_g1_i1
Sequence
(Amino Acid)
MPRWSALIRHGQTSIWLFLCLVYLVIATPGPCEVETGQSSIIVDIEESRGDQVNQSTVPA
ILPVVGEPDVDVVLSTVFPKGPTLFQLDGKRLQLLQPLDRDADNLSHMVFQLVCQVKATK
KRRTIPVIVRVSDINDNAPVFQGTPYETSVSELAPIGTTIFEGIRAVDIDAGVNGLSEYF
IIQGDNQ
(61 a.a.)

- SilkBase 1999-2023 -