SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG2111_internal:A_BomoASG_c12659_g1_i1
Scaffold_idBomo_Chr8
NCBI non-redundant
(nr)
cell_cycle_checkpoint_kinase_2_[Bombyx_mori]
Ontology
GO:0000077 P DNA damage checkpoint signaling
GO:0000086 P G2/M transition of mitotic cell cycle
GO:0000166 F nucleotide binding
GO:0000781 C chromosome, telomeric region
GO:0001302 P obsolete replicative cell aging
GO:0001934 P positive regulation of protein phosphorylation
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005794 C Golgi apparatus
GO:0006281 P DNA repair
GO:0006302 P double-strand break repair
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006468 P protein phosphorylation
GO:0006915 P apoptotic process
GO:0006974 P cellular response to DNA damage stimulus
GO:0006975 P DNA damage induced protein phosphorylation
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0008630 P intrinsic apoptotic signaling pathway in response to DNA damage
GO:0010332 P response to gamma radiation
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016605 C PML body
GO:0016740 F transferase activity
GO:0018105 P peptidyl-serine phosphorylation
GO:0019901 F protein kinase binding
GO:0031625 F ubiquitin protein ligase binding
GO:0035690 P cellular response to xenobiotic stimulus
GO:0042176 P regulation of protein catabolic process
GO:0042770 P signal transduction in response to DNA damage
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0044257 P cellular protein catabolic process
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046777 P protein autophosphorylation
GO:0046872 F metal ion binding
GO:0050821 P protein stabilization
GO:0051301 P cell division
GO:0071157 P regulation of cell cycle
GO:0072428 P mitotic intra-S DNA damage checkpoint signaling
GO:0090307 P mitotic spindle assembly
GO:1902520 P response to doxorubicin
GO:1903926 P cellular response to bisphenol A
GO:2000002 P negative regulation of DNA damage checkpoint
GO:2000210 P positive regulation of anoikis
RNA-seq EntryA_BomoASG_c12659_g1_i1
Sequence
(Amino Acid)
RSEDSFMKTMCGTPLYLAPEVLRANGQNTYGPEVDVWSLGVIFFVCLVGYLPFSHDYKEM
SLKNQILNGQYKFSQAHWKNISLQAKLLMKRMLTVQVSRRITLDQILNHAWMQDVDTIIR
VEKLLSHIRSKGMKQATNSTTGDGDDNVRNSTVAIIQVVAAGKRALSDTFCATEPNAKKI
KIALTNDDETSST
(63 a.a.)

- SilkBase 1999-2023 -