SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG2065_internal:A_BomoASG_c12499_g1_i2
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)		basement_membrane-specific_heparan_sulfate_proteoglycan_core_protein-like_isoform_X1_[Bombyx_mori]
Ontology
GO:0001822 P kidney development
GO:0001932 P regulation of protein phosphorylation
GO:0001942 P hair follicle development
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005886 C plasma membrane
GO:0006897 P endocytosis
GO:0007275 P multicellular organism development
GO:0008104 P protein localization
GO:0009953 P dorsal/ventral pattern formation
GO:0009954 P proximal/distal pattern formation
GO:0009986 C cell surface
GO:0014069 C postsynaptic density
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016055 P Wnt signaling pathway
GO:0016600 C flotillin complex
GO:0030154 P cell differentiation
GO:0030178 P negative regulation of Wnt signaling pathway
GO:0030279 P negative regulation of ossification
GO:0030326 P embryonic limb morphogenesis
GO:0030425 C dendrite
GO:0030509 P BMP signaling pathway
GO:0030971 F receptor tyrosine kinase binding
GO:0031594 C neuromuscular junction
GO:0034185 F apolipoprotein binding
GO:0042475 P odontogenesis of dentin-containing tooth
GO:0042733 P embryonic digit morphogenesis
GO:0042803 F protein homodimerization activity
GO:0043025 C neuronal cell body
GO:0043113 P receptor clustering
GO:0048513 P animal organ development
GO:0048813 P dendrite morphogenesis
GO:0048856 P anatomical structure development
GO:0050731 P positive regulation of peptidyl-tyrosine phosphorylation
GO:0050771 P negative regulation of axonogenesis
GO:0050808 P synapse organization
GO:0051124 P synaptic assembly at neuromuscular junction
GO:0051290 P protein heterotetramerization
GO:0060173 P limb development
GO:0060828 P regulation of canonical Wnt signaling pathway
GO:0071340 P skeletal muscle acetylcholine-gated channel clustering
GO:0090090 P negative regulation of canonical Wnt signaling pathway
GO:0097060 C synaptic membrane
GO:0097104 P postsynaptic membrane assembly
GO:0097105 P presynaptic membrane assembly
GO:0097110 F scaffold protein binding
GO:1901631 P positive regulation of presynaptic membrane organization
GO:1904395 P positive regulation of skeletal muscle acetylcholine-gated channel clustering
RNA-seq EntryA_BomoASG_c12499_g1_i2
Sequence
(Amino Acid)
YVNLHIEGIKCSELDFRCSDNSGCIDKSLVCNGFRDCYDDSDEENCLYRNKRYFKSWQSE
DELLPVGNIGTGCVAVYVGPRSVPCFCFAFICTRLLEPMKYKNNQER
(34 a.a.)

- SilkBase 1999-2023 -