SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG1968_internal:A_BomoASG_c12314_g1_i1
Scaffold_idBomo_Chr8
NCBI non-redundant
(nr)
integrin_alpha-PS1_precursor_[Bombyx_mori]
Ontology
GO:0004872 F signaling receptor activity
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005925 C focal adhesion
GO:0007015 P actin filament organization
GO:0007155 P cell adhesion
GO:0007157 P heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0007160 P cell-matrix adhesion
GO:0007229 P integrin-mediated signaling pathway
GO:0007411 P axon guidance
GO:0007414 P axonal defasciculation
GO:0007424 P open tracheal system development
GO:0007426 P tracheal outgrowth, open tracheal system
GO:0007427 P epithelial cell migration, open tracheal system
GO:0007431 P salivary gland development
GO:0007432 P salivary gland boundary specification
GO:0007435 P salivary gland morphogenesis
GO:0007475 P apposition of dorsal and ventral imaginal disc-derived wing surfaces
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0007494 P midgut development
GO:0007608 P sensory perception of smell
GO:0008305 C integrin complex
GO:0009925 C basal plasma membrane
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016203 P muscle attachment
GO:0016324 C apical plasma membrane
GO:0016328 C lateral plasma membrane
GO:0016337 P cell-cell adhesion
GO:0016477 P cell migration
GO:0030154 P cell differentiation
GO:0033627 P cell adhesion mediated by integrin
GO:0034446 P substrate adhesion-dependent cell spreading
GO:0035160 P maintenance of epithelial integrity, open tracheal system
GO:0046982 F protein heterodimerization activity
GO:0048567 P ectodermal digestive tract morphogenesis
GO:0050839 F cell adhesion molecule binding
GO:0050840 F extracellular matrix binding
RNA-seq EntryA_BomoASG_c12314_g1_i1
Sequence
(Amino Acid)
SGKQESQFGISIANASDLNKDGCQDIAIGSPYEGNGVVYIYMGNRRTGLNSIPDQVISAE
SLPIVLKTFGYSLSGGIDLDANGYPDLLVGAYENSSVALIRTRPIIDIKTSIRPSNT
(38 a.a.)

- SilkBase 1999-2023 -