SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG1915_complete:A_BomoASG_c12254_g1_i1
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)		PREDICTED:_paired_box_protein_Pax-6-like_[Amyelois_transitella]
Ontology
GO:0000790 C chromatin
GO:0000979 F RNA polymerase II core promoter sequence-specific DNA binding
GO:0000981 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001755 P neural crest cell migration
GO:0001764 P neuron migration
GO:0002064 P epithelial cell development
GO:0003309 P type B pancreatic cell differentiation
GO:0003310 P pancreatic A cell differentiation
GO:0003322 P pancreatic A cell development
GO:0003677 F DNA binding
GO:0003680 F minor groove of adenine-thymine-rich DNA binding
GO:0003690 F double-stranded DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0004842 F ubiquitin-protein transferase activity
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006366 P transcription by RNA polymerase II
GO:0007275 P multicellular organism development
GO:0007417 P central nervous system development
GO:0007420 P brain development
GO:0010628 P positive regulation of gene expression
GO:0010975 P regulation of neuron projection development
GO:0016567 P protein ubiquitination
GO:0021510 P spinal cord development
GO:0021549 P cerebellum development
GO:0021593 P rhombomere morphogenesis
GO:0021772 P olfactory bulb development
GO:0022027 P interkinetic nuclear migration
GO:0030154 P cell differentiation
GO:0030902 P hindbrain development
GO:0032869 P cellular response to insulin stimulus
GO:0035690 P cellular response to xenobiotic stimulus
GO:0042660 P positive regulation of cell fate specification
GO:0043565 F sequence-specific DNA binding
GO:0044344 P cellular response to fibroblast growth factor stimulus
GO:0045471 P response to ethanol
GO:0045664 P regulation of neuron differentiation
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0048708 P astrocyte differentiation
GO:0050767 P regulation of neurogenesis
GO:0050768 P negative regulation of neurogenesis
GO:0060041 P retina development in camera-type eye
GO:0061351 P neural precursor cell proliferation
GO:0070094 P positive regulation of glucagon secretion
GO:0071333 P cellular response to glucose stimulus
GO:0071380 P cellular response to prostaglandin E stimulus
GO:1901142 P insulin metabolic process
GO:2001224 P positive regulation of neuron migration
RNA-seq EntryA_BomoASG_c12254_g1_i1
Sequence
(Amino Acid)
MLISAGSGPTPEFSPVSCCASWKMESAPPAPAAITQPLNISTNVPVSPSSSTGGAGGGSG
TPLYPGAASHPLSSLLSQQRLLELSRFGLRHYDIAHHVLSQQGAVTKLLGTLRPPGLIGG
SKPKVATPAVVSKIEQYKRENPTIFAWEIRERLISEGVCTNATAPSVSSINRILRNRAAE
RAAAEFARAAGYGLYAAPPPYGAFPWAGGGGVWPPGTLSLPPGVPGPPTGVPHPDVVQQG
YLSSGRGLIDVDGDDSGSLDGEQPKFRRNRTTFSQDQLEELEKEFEKSHYPCVSTRERLA
SKTSLSEARVQVWFSNRRAKWRRHQRMNLLKRGGGSSPRHPARSPSRSPSRSLSPPRGPF
PPQMGGENSAFKALSHQDTNALKALSHQTQFDSNALKALSQQSAFDGTFKPHPALESSAF
KALVPHSAAAALLAAQSIQLARGYESHSDSDEEINVHDESDDEGGKNKSLTRSPSPNRHR
PPVSNDIPLQLTKHDR
*(164 a.a.)

- SilkBase 1999-2023 -