| Name | O_BomoASG19030_complete:A_BomoASG_c30422_g1_i2 |
| Scaffold_id | Bomo_Chr11 |
NCBI non-redundant
(nr) | mitochondrial_ribosome-associated_GTPase_2_[Bombyx_mori] |
| Ontology |
| GO:0000166 |
F |
nucleotide binding |
| GO:0000287 |
F |
magnesium ion binding |
| GO:0003924 |
F |
GTPase activity |
| GO:0005525 |
F |
GTP binding |
| GO:0005739 |
C |
mitochondrion |
| GO:0005743 |
C |
mitochondrial inner membrane |
| GO:0005759 |
C |
mitochondrial matrix |
| GO:0005761 |
C |
mitochondrial ribosome |
| GO:0006417 |
P |
regulation of translation |
| GO:0008152 |
P |
metabolic process |
| GO:0016020 |
C |
membrane |
| GO:0042254 |
P |
ribosome biogenesis |
| GO:0044065 |
P |
regulation of respiratory system process |
| GO:0046872 |
F |
metal ion binding |
| GO:0070129 |
P |
regulation of mitochondrial translation |
|
| RNA-seq Entry | A_BomoASG_c30422_g1_i2 |
Sequence
(Amino Acid) | MNYGLGIQFLQHVERCRGLVFLLDGSSSPGDQLRVLRRELRGYSAALARRPALLVVNKID
LPEAKRNYELMRNDYDNVIGVSAKYGVNLQQLLAAIRAIYDENDFRE
*(35 a.a.) |
