SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG18327_complete:A_BomoASG_c30183_g1_i2
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)		ATP-dependent_RNA_helicase_SUV3_homolog,_mitochondrial_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000963 P mitochondrial RNA processing
GO:0003677 F DNA binding
GO:0003678 F DNA helicase activity
GO:0004386 F helicase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005739 C mitochondrion
GO:0005759 C mitochondrial matrix
GO:0006119 P oxidative phosphorylation
GO:0016787 F hydrolase activity
GO:0016817 F hydrolase activity, acting on acid anhydrides
GO:0022904 P respiratory electron transport chain
GO:0032508 P DNA duplex unwinding
GO:0044528 P regulation of mitochondrial mRNA stability
GO:0070131 P positive regulation of mitochondrial translation
GO:0090646 P mitochondrial tRNA processing
GO:0097222 P mitochondrial mRNA polyadenylation
RNA-seq EntryA_BomoASG_c30183_g1_i2
Sequence
(Amino Acid)
MFPDVKLVRDMETELDAIIQQGIFQITRLLRNSEQMIRDEDSGFAIGHGSKRVNKMLAGQ
SMGEEKGKLSELLVARMLKKLQQELSTDKKIDRTKKNRNRRK
*(33 a.a.)

- SilkBase 1999-2023 -