SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG1811_internal:A_BomoASG_c11727_g1_i1
Scaffold_idBomo_Chr24
NCBI non-redundant
(nr)		PREDICTED:_leucine-rich_repeat_serine/threonine-protein_kinase_1_[Acyrthosiphon_pisum]
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005524 F ATP binding
GO:0005525 F GTP binding
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0006468 P protein phosphorylation
GO:0006979 P response to oxidative stress
GO:0007264 P small GTPase mediated signal transduction
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0034613 P cellular protein localization
GO:0034976 P response to endoplasmic reticulum stress
GO:0043025 C neuronal cell body
GO:0046872 F metal ion binding
GO:0048489 P synaptic vesicle transport
GO:0048846 P axon extension involved in axon guidance
GO:1901215 P negative regulation of neuron death
RNA-seq EntryA_BomoASG_c11727_g1_i1
Sequence
(Amino Acid)
LFRSAFGTVLTGTWRRSPANLVPVAIKALQPVPPPSHHDVPAQQAYKAALSRWDRDPLSA
ACRAYCGLRQELGIVLRLSHPHVVSLRAVCAAPLALLLELAPQGALDAAL
(35 a.a.)

- SilkBase 1999-2023 -