SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG179_internal:A_BomoASG_c1410_g1_i1
Scaffold_idBomo_Chr3
NCBI non-redundant
(nr)		integrin_beta-nu_precursor_[Bombyx_mori]
Ontology
GO:0005515 F protein binding
GO:0007155 P cell adhesion
GO:0007229 P integrin-mediated signaling pathway
GO:0008305 C integrin complex
GO:0009986 C cell surface
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0031430 C M band
GO:0032956 P regulation of actin cytoskeleton organization
GO:0040017 P positive regulation of locomotion
GO:0043005 C neuron projection
GO:0043025 C neuronal cell body
GO:0045987 P positive regulation of smooth muscle contraction
GO:0055001 P muscle cell development
GO:0055120 C striated muscle dense body
GO:0060279 P positive regulation of ovulation
GO:1903356 P positive regulation of distal tip cell migration
GO:1904901 P positive regulation of myosin II filament organization
RNA-seq EntryA_BomoASG_c1410_g1_i1
Sequence
(Amino Acid)
FSHAAPRCNDDESLVSTGCSQAMIQRPEKPIWVVAENSSLQDMQPDSEESVVQIQPQRIK
LSLKPRETKKIKFVYRPAKNYPLDLYYLMDLTWSMKDDKETLVS
(33 a.a.)

- SilkBase 1999-2023 -