SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG17933_3prime_partial:A_BomoASG_c30022_g1_i3
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)
SH3_and_multiple_ankyrin_repeat_domains_protein_3_[Bombyx_mori]
Ontology
GO:0000165 P MAPK cascade
GO:0001838 P embryonic epithelial tube formation
GO:0003779 F actin binding
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0007416 P synapse assembly
GO:0007611 P learning or memory
GO:0007612 P learning
GO:0007613 P memory
GO:0007626 P locomotory behavior
GO:0008022 F protein C-terminus binding
GO:0008270 F zinc ion binding
GO:0014069 C postsynaptic density
GO:0016020 C membrane
GO:0017124 F SH3 domain binding
GO:0021773 P striatal medium spiny neuron differentiation
GO:0030054 C cell junction
GO:0030160 F synaptic receptor adaptor activity
GO:0030534 P adult behavior
GO:0032232 P negative regulation of actin filament bundle assembly
GO:0035176 P social behavior
GO:0035255 F ionotropic glutamate receptor binding
GO:0035640 P exploration behavior
GO:0035641 P locomotory exploration behavior
GO:0040011 P locomotion
GO:0042297 P vocal learning
GO:0042802 F identical protein binding
GO:0042995 C cell projection
GO:0043005 C neuron projection
GO:0043197 C dendritic spine
GO:0044309 C neuron spine
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
GO:0045794 P negative regulation of cell volume
GO:0048167 P regulation of synaptic plasticity
GO:0048170 P positive regulation of long-term neuronal synaptic plasticity
GO:0048854 P brain morphogenesis
GO:0050885 P neuromuscular process controlling balance
GO:0051835 P positive regulation of synapse structural plasticity
GO:0051968 P positive regulation of synaptic transmission, glutamatergic
GO:0060076 C excitatory synapse
GO:0060170 C ciliary membrane
GO:0060291 P long-term synaptic potentiation
GO:0060292 P long-term synaptic depression
GO:0060997 P dendritic spine morphogenesis
GO:0060999 P positive regulation of dendritic spine development
GO:0061001 P regulation of dendritic spine morphogenesis
GO:0071625 P vocalization behavior
GO:0097107 P postsynaptic density assembly
GO:0097110 F scaffold protein binding
GO:0097113 P AMPA glutamate receptor clustering
GO:0097114 P NMDA glutamate receptor clustering
GO:0097117 P guanylate kinase-associated protein clustering
GO:0097481 C postsynaptic density
GO:1900271 P regulation of long-term synaptic potentiation
GO:1900273 P positive regulation of long-term synaptic potentiation
GO:1900451 P positive regulation of glutamate receptor signaling pathway
GO:1900452 P regulation of long-term synaptic depression
GO:1904717 P regulation of AMPA glutamate receptor clustering
GO:2000463 P positive regulation of excitatory postsynaptic potential
GO:2000821 P regulation of grooming behavior
GO:2000822 P regulation of behavioral fear response
GO:2000969 P positive regulation of AMPA receptor activity
RNA-seq EntryA_BomoASG_c30022_g1_i3
Sequence
(Amino Acid)
MEGECSEGAEGWLLVRVHVPELNVQKSLQFPRDQLVWDVKQQCLAALPKVATWYRELKES
FNYGLFCPPVNGKAGKFLDEERRLGDYPFNGPVGYLELKYKRRVYKMLKLDEKTLKALHS
RANLRRFLEHVTHGQIDKITKACAKGLDPNFHCQETGETPLTIAAGLKSPAKILIALVNG
GALLDYRTRDGSTAMHRAVEKNSLEAVKTLLELGASPNYKDGKGLTPLYLSVTNKTDPLL
CETLLHDHATIGATDLQGWQEVHQACRNGLVQHVDHLLFYGADMNARNASGNTPLHVCAV
NAQDSCARQLLFRGCDKEALNFANQTPYQVAVIAGNLDLAEVIKNYKSDEIVPFRGPPRY
NPRRRSAADRKSV
(123 a.a.)

- SilkBase 1999-2023 -