SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG17721_5prime_partial:A_BomoASG_c29961_g1_i2
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)
LOW_QUALITY_PROTEIN:_importin_subunit_beta-1_[Bombyx_mori]
Ontology
GO:0000059 P obsolete protein import into nucleus, docking
GO:0000060 P obsolete protein import into nucleus, translocation
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005635 C nuclear envelope
GO:0005643 C nuclear pore
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006309 P apoptotic DNA fragmentation
GO:0006606 P protein import into nucleus
GO:0006607 P NLS-bearing protein import into nucleus
GO:0006610 P ribosomal protein import into nucleus
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0007079 P mitotic chromosome movement towards spindle pole
GO:0007080 P mitotic metaphase plate congression
GO:0008139 F nuclear localization sequence binding
GO:0008270 F zinc ion binding
GO:0008536 F small GTPase binding
GO:0008565 F obsolete protein transporter activity
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016032 P viral process
GO:0019054 P modulation by virus of host cellular process
GO:0019899 F enzyme binding
GO:0019904 F protein domain specific binding
GO:0030953 P astral microtubule organization
GO:0031291 P Ran protein signal transduction
GO:0031965 C nuclear membrane
GO:0034399 C nuclear periphery
GO:0040001 P establishment of mitotic spindle localization
GO:0043234 C protein-containing complex
GO:0044822 F RNA binding
GO:0045184 P establishment of protein localization
GO:0051879 F Hsp90 protein binding
GO:0070062 C extracellular exosome
GO:0071782 C endoplasmic reticulum tubular network
GO:0075733 P intracellular transport of virus
GO:0090307 P mitotic spindle assembly
RNA-seq EntryA_BomoASG_c29961_g1_i2
Sequence
(Amino Acid)
CSSDLTMVILERLQQVLQMEIHVSSQADRSQFNDLQSLLCATLHSVLKKVTPDDAPQISD
TIMTALLTVFASNAGKAGSVQEDALMAVSTLVEVLGEEFLKYMDTFKKYLYTGLKNHQEY
QVCIAAVGLTGDICRALKNKMAPYCDEIIVLLLENLGDPSIHRSVKPEILSVFGDIALSI
GSDFGKYFDVVMQMLLQASNAQVDHNDYDMVEYLGELRESVLEAYTGIIQGLKGVGSQVR
PDIAIVEPHVPAIVNFMIQVANEEDRTDAQMAVISGLMGDLTNAFGAHVLPMLDTKPLTD
MLQVARRSRVARTKTLANWATKEMRRVKQTLPLAS
*(111 a.a.)

- SilkBase 1999-2023 -