SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG1769_complete:A_BomoASG_c11386_g1_i1
Scaffold_idBomo_Chr17
NCBI non-redundant
(nr)		26S_proteasome_non-ATPase_regulatory_subunit_10-like_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000165 P MAPK cascade
GO:0000209 P protein polyubiquitination
GO:0000502 C proteasome complex
GO:0002223 P stimulatory C-type lectin receptor signaling pathway
GO:0002479 P antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005838 C proteasome regulatory particle
GO:0006521 P regulation of cellular amino acid metabolic process
GO:0006915 P apoptotic process
GO:0007253 P cytoplasmic sequestering of NF-kappaB
GO:0008134 F transcription factor binding
GO:0008540 C proteasome regulatory particle, base subcomplex
GO:0030307 P positive regulation of cell growth
GO:0031145 P anaphase-promoting complex-dependent catabolic process
GO:0031398 P positive regulation of protein ubiquitination
GO:0032088 P negative regulation of NF-kappaB transcription factor activity
GO:0032436 P positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0033209 P tumor necrosis factor-mediated signaling pathway
GO:0038061 P NIK/NF-kappaB signaling
GO:0038095 P Fc-epsilon receptor signaling pathway
GO:0043066 P negative regulation of apoptotic process
GO:0043161 P proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0043409 P negative regulation of MAPK cascade
GO:0043488 P regulation of mRNA stability
GO:0043518 P negative regulation of DNA damage response, signal transduction by p53 class mediator
GO:0045111 C intermediate filament cytoskeleton
GO:0045737 P positive regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0050852 P T cell receptor signaling pathway
GO:0051436 P obsolete negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle
GO:0051437 P obsolete positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition
GO:0060071 P Wnt signaling pathway, planar cell polarity pathway
GO:0070682 P proteasome regulatory particle assembly
GO:0090090 P negative regulation of canonical Wnt signaling pathway
GO:0090201 P negative regulation of release of cytochrome c from mitochondria
GO:0090263 P positive regulation of canonical Wnt signaling pathway
RNA-seq EntryA_BomoASG_c11386_g1_i1
Sequence
(Amino Acid)
MSIGSIYEKAYKGDFNQVKVKIDEDVSLLNISDSNNRLLIHWAALGGNKHLVDFLLESGS
CLDPVDDTDSTPLILAASAGRLDVVKLLISKGSNVNHKTNRGQTSLHYACSKGHKEVVNL
LLDADAHINSADILGATPLHRAAAQGRNNILEVLLSSPNIKLDLQDSTGSTPLHLACEED
REAAATMLVESGADLNIENKEKKTPLDLCSVKLKTNLSKIKK
*(73 a.a.)

- SilkBase 1999-2023 -