SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG1768_5prime_partial:A_BomoASG_c11380_g1_i1
Scaffold_idBomo_Chr10
NCBI non-redundant
(nr)
LOW_QUALITY_PROTEIN:_notch-like_protein_isoform_X1_[Bombyx_mori]
Ontology
GO:0001501 P skeletal system development
GO:0001527 C microfibril
GO:0001656 P metanephros development
GO:0001822 P kidney development
GO:0005178 F integrin binding
GO:0005201 F extracellular matrix structural constituent
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005578 C extracellular matrix
GO:0005604 C basement membrane
GO:0005615 C extracellular space
GO:0007507 P heart development
GO:0022617 P extracellular matrix disassembly
GO:0030023 F extracellular matrix constituent conferring elasticity
GO:0030198 P extracellular matrix organization
GO:0031012 C extracellular matrix
GO:0032403 F protein-containing complex binding
GO:0035582 P sequestering of BMP in extracellular matrix
GO:0035583 P sequestering of TGFbeta in extracellular matrix
GO:0043010 P camera-type eye development
GO:0048048 P embryonic eye morphogenesis
GO:0048050 P post-embryonic eye morphogenesis
GO:0070062 C extracellular exosome
GO:0071560 P cellular response to transforming growth factor beta stimulus
GO:0090287 P regulation of cellular response to growth factor stimulus
GO:1990314 P cellular response to insulin-like growth factor stimulus
RNA-seq EntryA_BomoASG_c11380_g1_i1
Sequence
(Amino Acid)
CQCAAGFVGSPPKIGCRAPCEDVKCGKHAYCKPDGMEAYCVCEDGWTFNPHDIAAGCIDL
DECDISLGPVGRCGKNAICSNTPGSFSCNCPEGYTGDAYKQCSDIDECQLEGACGLGADC
LNRDGSYSCECPDGTIPDPDPHIR
*(47 a.a.)

- SilkBase 1999-2023 -