SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG17685_internal:A_BomoASG_c29941_g1_i1
Scaffold_idBomo_Chr27
NCBI non-redundant
(nr)
delta(24)-sterol_reductase_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0000246 F delta24(24-1) sterol reductase activity
GO:0003824 F catalytic activity
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0006629 P lipid metabolic process
GO:0006694 P steroid biosynthetic process
GO:0006695 P cholesterol biosynthetic process
GO:0006979 P response to oxidative stress
GO:0007265 P Ras protein signal transduction
GO:0008104 P protein localization
GO:0008202 P steroid metabolic process
GO:0008203 P cholesterol metabolic process
GO:0008285 P negative regulation of cell population proliferation
GO:0009725 P response to hormone
GO:0009888 P tissue development
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016125 P sterol metabolic process
GO:0016126 P sterol biosynthetic process
GO:0016491 F oxidoreductase activity
GO:0016614 F oxidoreductase activity, acting on CH-OH group of donors
GO:0016628 F oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor
GO:0019899 F enzyme binding
GO:0030539 P male genitalia development
GO:0031639 P plasminogen activation
GO:0042605 F peptide antigen binding
GO:0042987 P amyloid precursor protein catabolic process
GO:0043066 P negative regulation of apoptotic process
GO:0043154 P negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043588 P skin development
GO:0050614 F delta24-sterol reductase activity
GO:0050660 F flavin adenine dinucleotide binding
GO:0055114 P obsolete oxidation-reduction process
GO:0061024 P membrane organization
RNA-seq EntryA_BomoASG_c29941_g1_i1
Sequence
(Amino Acid)
IGRALKRKRTAIEYIPLRDYYHRHTRSLFWELQDIISFGNNFIFRYLFGWLMPPEVSLLK
LTQPEAVTKLYNKAHVIQDMLIPIELLEKAIAFFHDEFEVYPIWLCPFKIFNNPGQLKIK
PGEESQMFVDIGVYGVPKAKGFETIASTRHVESFVIQNQGFQMLYADTYTTREEFRQMFD
HKLYDRVRASLPNCKEAFPE
(65 a.a.)

- SilkBase 1999-2023 -