SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG1757_internal:A_BomoASG_c11319_g1_i1
Scaffold_idBomo_Chr8
NCBI non-redundant
(nr)
rac_GTPase-activating_protein_1_isoform_X2_[Bombyx_mori]
Ontology
GO:0000281 P mitotic cytokinesis
GO:0000915 P actomyosin contractile ring assembly
GO:0001669 C acrosomal vesicle
GO:0005096 F GTPase activator activity
GO:0005515 F protein binding
GO:0005547 F phosphatidylinositol-3,4,5-trisphosphate binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005819 C spindle
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005874 C microtubule
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006890 P retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
GO:0007018 P microtubule-based movement
GO:0007049 P cell cycle
GO:0007165 P signal transduction
GO:0007275 P multicellular organism development
GO:0007283 P spermatogenesis
GO:0007405 P neuroblast proliferation
GO:0008017 F microtubule binding
GO:0008272 P sulfate transport
GO:0008289 F lipid binding
GO:0009790 P embryo development
GO:0016020 C membrane
GO:0019886 P antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0019901 F protein kinase binding
GO:0030154 P cell differentiation
GO:0030496 C midbody
GO:0031234 C extrinsic component of cytoplasmic side of plasma membrane
GO:0031410 C cytoplasmic vesicle
GO:0032154 C cleavage furrow
GO:0032467 P positive regulation of cytokinesis
GO:0035556 P intracellular signal transduction
GO:0043014 F alpha-tubulin binding
GO:0043015 F gamma-tubulin binding
GO:0043547 P positive regulation of GTPase activity
GO:0046872 F metal ion binding
GO:0048487 F beta-tubulin binding
GO:0051056 P regulation of small GTPase mediated signal transduction
GO:0051233 C spindle midzone
GO:0051256 P mitotic spindle midzone assembly
GO:0051301 P cell division
GO:0051988 P regulation of attachment of spindle microtubules to kinetochore
GO:0070062 C extracellular exosome
GO:0072686 C mitotic spindle
GO:0097149 C centralspindlin complex
RNA-seq EntryA_BomoASG_c11319_g1_i1
Sequence
(Amino Acid)
NFYKRETCGPCGKTIKFAKMGVKCESCRGQAHHECRAMLPLPCVPPPAQAPRHTQQEGCI
SDYAPTTPPMVPALMVHCINEIEKRGLSERGIYRISATEKDVKRLKERFLRGHGSPWLAG
EDVHAVCGCVKDFLRGL
(44 a.a.)

- SilkBase 1999-2023 -