SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG17501_internal:A_BomoASG_c29878_g1_i1
Scaffold_idBomo_Chr2
NCBI non-redundant
(nr)
paired_amphipathic_helix_protein_Sin3a_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000183 P rDNA heterochromatin assembly
GO:0000776 C kinetochore
GO:0000785 C chromatin
GO:0000976 F transcription cis-regulatory region binding
GO:0001102 F RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001103 F RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001106 F transcription corepressor activity
GO:0001701 P in utero embryonic development
GO:0002218 P activation of innate immune response
GO:0002230 P positive regulation of defense response to virus by host
GO:0002244 P hematopoietic progenitor cell differentiation
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003714 F transcription corepressor activity
GO:0003723 F RNA binding
GO:0004407 F histone deacetylase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005667 C transcription regulator complex
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0006260 P DNA replication
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006476 P protein deacetylation
GO:0007568 P aging
GO:0008134 F transcription factor binding
GO:0010243 P response to organonitrogen compound
GO:0010817 P regulation of hormone levels
GO:0010971 P positive regulation of G2/M transition of mitotic cell cycle
GO:0016575 P histone deacetylation
GO:0016580 C Sin3 complex
GO:0017053 C transcription repressor complex
GO:0031937 P obsolete positive regulation of chromatin silencing
GO:0032403 F protein-containing complex binding
GO:0033558 F protein deacetylase activity
GO:0034613 P cellular protein localization
GO:0042754 P negative regulation of circadian rhythm
GO:0043066 P negative regulation of apoptotic process
GO:0043234 C protein-containing complex
GO:0043619 P regulation of transcription from RNA polymerase II promoter in response to oxidative stress
GO:0045171 C intercellular bridge
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0048511 P rhythmic process
GO:0051595 P response to methylglyoxal
GO:0071333 P cellular response to glucose stimulus
GO:1900181 P negative regulation of protein localization to nucleus
GO:1901675 P negative regulation of histone H3-K27 acetylation
GO:1903351 P cellular response to dopamine
GO:2000678 P negative regulation of transcription regulatory region DNA binding
RNA-seq EntryA_BomoASG_c29878_g1_i1
Sequence
(Amino Acid)
CAAPPARPRHDRPPALALRLAPAHHLPADVSSPTEYYNLLLDLVKGVLDGNMESSAFEDA
AREMLGIKAYPAYTLDKLVSIAVRQLQHCASEPWSVRAAELCARDMRAAAGPYVRRALAA
LRPHHAAFLVRAYGGDECKVTFELLESAGEGRTSPHNNDNRMSPTAQRTSGGVGGVKSVG
EGEAVSRCAAWSLYAERFASNKTSGVTARGKPVFLARNARAR
(73 a.a.)

- SilkBase 1999-2023 -