SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG1738_internal:A_BomoASG_c11162_g1_i1
Scaffold_idBomo_Chr12
NCBI non-redundant
(nr)		zinc_finger_protein_506-like_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000278 P mitotic cell cycle
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001078 F DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0008168 F methyltransferase activity
GO:0016568 P chromatin organization
GO:0016575 P histone deacetylation
GO:0016740 F transferase activity
GO:0032259 P methylation
GO:0043565 F sequence-specific DNA binding
GO:0044212 F transcription cis-regulatory region binding
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
GO:0051567 P histone H3-K9 methylation
GO:0070491 F DNA-binding transcription factor binding
RNA-seq EntryA_BomoASG_c11162_g1_i1
Sequence
(Amino Acid)
HGNERSYGCKHCPKKFKVPGSLNSHVLWNHKRTRNYKCEVCNATFISSSSKSSHIRKNHL
KEKKYRCDTCGKRFFSKSELQRHSLTHTGVKNFHCHLCDKSYQTRYGLNVHLKSQ
(37 a.a.)

- SilkBase 1999-2023 -