SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG17252_internal:A_BomoASG_c29779_g1_i3
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)
zinc_finger_protein_629_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003705 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005634 C nucleus
GO:0005700 C polytene chromosome
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0007219 P Notch signaling pathway
GO:0007275 P multicellular organism development
GO:0007411 P axon guidance
GO:0007422 P peripheral nervous system development
GO:0007423 P sensory organ development
GO:0007601 P visual perception
GO:0008407 P chaeta morphogenesis
GO:0008594 P photoreceptor cell morphogenesis
GO:0016360 P sensory organ precursor cell fate determination
GO:0042051 P compound eye photoreceptor development
GO:0042059 P negative regulation of epidermal growth factor receptor signaling pathway
GO:0043066 P negative regulation of apoptotic process
GO:0043425 F bHLH transcription factor binding
GO:0043565 F sequence-specific DNA binding
GO:0045464 P R8 cell fate specification
GO:0045465 P R8 cell differentiation
GO:0045872 P obsolete positive regulation of rhodopsin gene expression
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046530 P photoreceptor cell differentiation
GO:0046872 F metal ion binding
GO:0048666 P neuron development
GO:0048813 P dendrite morphogenesis
GO:0050896 P response to stimulus
RNA-seq EntryA_BomoASG_c29779_g1_i3
Sequence
(Amino Acid)
ALPISSPERSVSPTSISSPHSPPRTPDSPLEHHLETAPLGDFELAGRALKHYARATELGA
LMYCSSLGALYGGAGVWPLLLPRTPTDFACTPTGQIKNSPTREDGEEELPLNLSMKNRQI
WSPGSVCEREQDDITLPICKWSRRDDDEAPLELVKRCRSSPESTERPTSTEPRRCPSAPA
HQSYQLPLPPPADLNYSLLLKNENKNEKTFQCKQCGKCFKRSSTLSTHLLIHSDTRPYPC
QYCGKRFHQKSDMKKHTYIHTGEKPHKCVVCSKAFSQSSNLITHMRKHTGYKPFSCGLCE
KAFQRKVDLRRHRDSQHSEMNEASTVTLQVPHRYRYYGDEASPPQIGR
(115 a.a.)

- SilkBase 1999-2023 -