SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG17216_internal:A_BomoASG_c29762_g1_i1
Scaffold_idBomo_Chr2
NCBI non-redundant
(nr)
probable_serine/threonine-protein_kinase_DDB_G0278901_isoform_X2_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0001707 P mesoderm formation
GO:0001893 P maternal placenta development
GO:0001935 P endothelial cell proliferation
GO:0001938 P positive regulation of endothelial cell proliferation
GO:0001946 P lymphangiogenesis
GO:0001974 P blood vessel remodeling
GO:0002063 P chondrocyte development
GO:0003085 P negative regulation of systemic arterial blood pressure
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004675 F transmembrane receptor protein serine/threonine kinase activity
GO:0004702 F obsolete signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005615 C extracellular space
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005901 C caveola
GO:0006366 P transcription by RNA polymerase II
GO:0006468 P protein phosphorylation
GO:0007178 P transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0007420 P brain development
GO:0009267 P cellular response to starvation
GO:0009925 C basal plasma membrane
GO:0009952 P anterior/posterior pattern specification
GO:0009986 C cell surface
GO:0010595 P positive regulation of endothelial cell migration
GO:0010634 P positive regulation of epithelial cell migration
GO:0010862 P positive regulation of pathway-restricted SMAD protein phosphorylation
GO:0014916 P regulation of lung blood pressure
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016324 C apical plasma membrane
GO:0016362 F activin receptor activity, type II
GO:0016740 F transferase activity
GO:0019838 F growth factor binding
GO:0023014 P signal transduction
GO:0030166 P proteoglycan biosynthetic process
GO:0030308 P negative regulation of cell growth
GO:0030425 C dendrite
GO:0030501 P positive regulation of bone mineralization
GO:0030509 P BMP signaling pathway
GO:0030513 P positive regulation of BMP signaling pathway
GO:0032924 P activin receptor signaling pathway
GO:0036122 F BMP binding
GO:0042127 P regulation of cell population proliferation
GO:0043025 C neuronal cell body
GO:0044214 C spanning component of plasma membrane
GO:0045669 P positive regulation of osteoblast differentiation
GO:0045906 P negative regulation of vasoconstriction
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0048010 P vascular endothelial growth factor receptor signaling pathway
GO:0048286 P lung alveolus development
GO:0048842 P positive regulation of axon extension involved in axon guidance
GO:0060041 P retina development in camera-type eye
GO:0060173 P limb development
GO:0060350 P endochondral bone morphogenesis
GO:0060836 P lymphatic endothelial cell differentiation
GO:0060840 P artery development
GO:0060841 P venous blood vessel development
GO:0061036 P positive regulation of cartilage development
GO:0061298 P retina vasculature development in camera-type eye
GO:0071773 P cellular response to BMP stimulus
GO:0072577 P endothelial cell apoptotic process
GO:0097481 C postsynaptic density
GO:0098821 F BMP receptor activity
GO:1902731 P negative regulation of chondrocyte proliferation
GO:2000279 P negative regulation of DNA biosynthetic process
RNA-seq EntryA_BomoASG_c29762_g1_i1
Sequence
(Amino Acid)
LSEIISSGRWFGKKDKIRKRSVTKPNEFGRLNDMNSNELVSGNIPVLSQFAADSVSKHTS
SIDHKISSQSKEVIIKNEIPSYIKNTNVKNAIVVTDPPTTMGPTISCIYKMQNVFHSATL
SYDDDTNAQTMTVNDVYRERPITDMKLETGETVRVEHCTHTRDVCYTFWHMQDQGNITIL
GQGCWRSAETARGISTCDKCMRAPKRLPGSKFCCCTKSYCNSDFLSLKEETVTISAESTM
NTASQQPSYSSLVASSSLALVAILVMAIVVKTFYCKRINIDKGELSDGTDVEKGDIMGNC
PDSLSTGLLCVDNLTLIEHIGQGKFGSVWRGSLGSTPVAVKLYSSSSAWQKETAIYALPH
LSHPNLLRYYGSETRPTLTEGGGREHLVVLELCVGTLRAKLQAQTLSWLEFATLAHGIAA
ALAHLHTPIGNKPCVVHRDVNSNNVLIASNGTARLADLGLAQVLQPRREHTAPNRITEAG
TLRYLAPEALEGALDLSGARAALCAVDVYALGLVLWELLWRTAPAHSGPTPCYMLPYQHL
GLPANPTLHHMQTLVSRKKARPPVPRGPGLAQCTAADTCDECCDHDAEARLTAVCVEERM
AELKQILQAQGPLIHDNNLHPNSETSPPSPADQDKNSNCTALRHGCDVTTPLLYPHPHMG
RNACIERNTHTSTQQYVTLIHKSLKDISDPSDAIRLENIDDNCLSVARGSPRVAVPENSG
PNVTRSHQRPLDYVQNDVSHHDVDRGPKQTNLLQETRTEKTGWGIRKFFEKFNKNKMDTE
VKLAPEGQRTRISVVNDKNNYNRPSNLVLSQDPNLIYEAPCLSPPNRTLSPNMMADATFK
EIPSHNDSHIYAVIVPKVQPDVSGIKSKNGSSSESLKQSVGTSASSQSVYRNNSESGDWT
LKNRLSRDNKPGSNSSSRASINLELQFIEGANPAASPFELNSDCSGSEDEQLLLLSENGG
SRITMQTVSKDPKYQNDVLKESQKKTVTFNKNHNRYSNFDNEVSDPNDKENVANGYSGDN
PAYLPAPSNAA
(342 a.a.)

- SilkBase 1999-2023 -