SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG1703_3prime_partial:A_BomoASG_c10789_g1_i1
Scaffold_idBomo_Chr21
NCBI non-redundant
(nr)		ras_GTPase-activating_protein_1_[Bombyx_mori]
Ontology
GO:0000281 P mitotic cytokinesis
GO:0001570 P vasculogenesis
GO:0001934 P positive regulation of protein phosphorylation
GO:0001953 P negative regulation of cell-matrix adhesion
GO:0005096 F GTPase activator activity
GO:0005161 F platelet-derived growth factor receptor binding
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0007155 P cell adhesion
GO:0007162 P negative regulation of cell adhesion
GO:0007165 P signal transduction
GO:0008134 F transcription factor binding
GO:0009790 P embryo development
GO:0016020 C membrane
GO:0019900 F kinase binding
GO:0030036 P actin cytoskeleton organization
GO:0030539 P male genitalia development
GO:0030833 P regulation of actin filament polymerization
GO:0030971 F receptor tyrosine kinase binding
GO:0031235 C intrinsic component of the cytoplasmic side of the plasma membrane
GO:0031965 C nuclear membrane
GO:0032403 F protein-containing complex binding
GO:0032868 P response to insulin
GO:0036120 P cellular response to platelet-derived growth factor stimulus
GO:0042493 P response to xenobiotic stimulus
GO:0043087 P regulation of GTPase activity
GO:0043422 F protein kinase B binding
GO:0043524 P negative regulation of neuron apoptotic process
GO:0043547 P positive regulation of GTPase activity
GO:0044325 F transmembrane transporter binding
GO:0044344 P cellular response to fibroblast growth factor stimulus
GO:0046326 P positive regulation of glucose import
GO:0046580 P negative regulation of Ras protein signal transduction
GO:0048146 P positive regulation of fibroblast proliferation
GO:0050731 P positive regulation of peptidyl-tyrosine phosphorylation
GO:0071364 P cellular response to epidermal growth factor stimulus
GO:0090630 P activation of GTPase activity
GO:1990782 F protein tyrosine kinase binding
RNA-seq EntryA_BomoASG_c10789_g1_i1
Sequence
(Amino Acid)
MADLIRAMGAPIGPPVKDKLGSPSTESEDGGGDIAELAAELELDEADGPSTNGERQAVLA
PPETEWYHGRLDRYTSEERLWAASKQGSYLVRESDRKPGSYVLSYLGRTGINHFRIT
(38 a.a.)

- SilkBase 1999-2023 -