SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG1687_internal:A_BomoASG_c10657_g1_i1
Scaffold_idBomo_Chr25
NCBI non-redundant
(nr)		eIF-2-alpha_kinase_GCN2_isoform_X2_[Bombyx_mori]
Ontology
GO:0000049 F tRNA binding
GO:0000166 F nucleotide binding
GO:0002230 P positive regulation of defense response to virus by host
GO:0002250 P adaptive immune response
GO:0002286 P T cell activation involved in immune response
GO:0002376 P immune system process
GO:0002821 P positive regulation of adaptive immune response
GO:0003723 F RNA binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004694 F eukaryotic translation initiation factor 2alpha kinase activity
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005844 C polysome
GO:0006417 P regulation of translation
GO:0006446 P regulation of translational initiation
GO:0006468 P protein phosphorylation
GO:0007049 P cell cycle
GO:0007050 P regulation of cell cycle
GO:0007399 P nervous system development
GO:0007612 P learning
GO:0007616 P long-term memory
GO:0010998 P regulation of translational initiation by eIF2 alpha phosphorylation
GO:0016032 P viral process
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0019081 P viral translation
GO:0022626 C cytosolic ribosome
GO:0032057 P negative regulation of translational initiation in response to stress
GO:0032792 P negative regulation of CREB transcription factor activity
GO:0034198 P cellular response to amino acid starvation
GO:0034644 P cellular response to UV
GO:0036492 P eiF2alpha phosphorylation in response to endoplasmic reticulum stress
GO:0039520 P induction by virus of host autophagy
GO:0044828 P negative regulation by host of viral genome replication
GO:0045665 P negative regulation of neuron differentiation
GO:0045947 P negative regulation of translational initiation
GO:0046777 P protein autophosphorylation
GO:0051607 P defense response to virus
GO:0060259 P regulation of feeding behavior
GO:0060733 P GCN2-mediated signaling
GO:0070417 P cellular response to cold
GO:0071264 P positive regulation of translational initiation in response to starvation
GO:1900273 P positive regulation of long-term synaptic potentiation
GO:1990138 P neuron projection extension
GO:1990253 P cellular response to leucine starvation
RNA-seq EntryA_BomoASG_c10657_g1_i1
Sequence
(Amino Acid)
VPEGALAGLLSHALSDRTARGYQRLVAACLDQRPSAAEDYTYHNGMKTKPARLLEFVKDA
VVKVFKSHGALEFAPPLLIPRARAWDQYPNAVKVMTSSGSVCHLPHDLRLPFARHIAYSG
IKNLRRFIVDRVYREKHVQGFHPKEILECAYDIVTPKTDSLWPDAELIEVASRAASECSL
KVSIQLNHTELIRVLLQSCGEIGRA
(67 a.a.)

- SilkBase 1999-2023 -