SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG16802_internal:A_BomoASG_c29612_g1_i1
Scaffold_idBomo_Chr12
NCBI non-redundant
(nr)
WD_repeat-containing_and_planar_cell_polarity_effector_protein_fritz_isoform_X5_[Bombyx_mori]
Ontology
GO:0001822 P kidney development
GO:0002093 P auditory receptor cell morphogenesis
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005929 C cilium
GO:0005930 C axoneme
GO:0005938 C cell cortex
GO:0007224 P smoothened signaling pathway
GO:0007399 P nervous system development
GO:0010762 P regulation of fibroblast migration
GO:0016020 C membrane
GO:0016324 C apical plasma membrane
GO:0016476 P regulation of embryonic cell shape
GO:0030030 P cell projection organization
GO:0032185 P septin cytoskeleton organization
GO:0032880 P regulation of protein localization
GO:0042384 P cilium assembly
GO:0042733 P embryonic digit morphogenesis
GO:0042995 C cell projection
GO:0043010 P camera-type eye development
GO:0044782 P cilium organization
GO:0045184 P establishment of protein localization
GO:0048568 P embryonic organ development
GO:0051893 P regulation of focal adhesion assembly
GO:0055123 P digestive system development
GO:0060021 P roof of mouth development
GO:0060271 P cilium assembly
GO:0060541 P respiratory system development
GO:0072358 P circulatory system development
GO:0090521 P glomerular visceral epithelial cell migration
GO:0097541 C axonemal basal plate
GO:1900027 P regulation of ruffle assembly
GO:2000114 P regulation of establishment of cell polarity
RNA-seq EntryA_BomoASG_c29612_g1_i1
Sequence
(Amino Acid)
IIHIVDQTASQKNCVTLRWMRYEVTESHTPKLQVSPENVTRLALPAPARVARRAPCDSRL
VAACIDGSVHVAHHTAGLTHSTKAGFIATDVRWAGELVIAIEENGRIQCFDRALSLLNHH
IKFLDLAADLSDAKRMKVLATLNAKCGPILLATFTGGPLALIHITHPRLITAWIRARRTS
SAVALLRAMVWEHEGNDCLWAVNKLICASLRSGAEAVAGDRK
(73 a.a.)

- SilkBase 1999-2023 -