SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG16794_internal:A_BomoASG_c29608_g1_i2
Scaffold_idBomo_Chr24
NCBI non-redundant
(nr)
suppressor_of_fused_homolog_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001843 P neural tube closure
GO:0001947 P heart looping
GO:0003281 P ventricular septum development
GO:0003714 F transcription corepressor activity
GO:0004871 F obsolete signal transducer activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005929 C cilium
GO:0007275 P multicellular organism development
GO:0007368 P determination of left/right symmetry
GO:0008013 F beta-catenin binding
GO:0008134 F transcription factor binding
GO:0019901 F protein kinase binding
GO:0021513 P spinal cord dorsal/ventral patterning
GO:0021775 P smoothened signaling pathway involved in ventral spinal cord interneuron specification
GO:0021776 P smoothened signaling pathway involved in spinal cord motor neuron cell fate specification
GO:0035904 P aorta development
GO:0042994 P cytoplasmic sequestering of transcription factor
GO:0043433 P negative regulation of DNA-binding transcription factor activity
GO:0043588 P skin development
GO:0045879 P negative regulation of smoothened signaling pathway
GO:0060976 P coronary vasculature development
GO:0072372 C cilium
GO:1901621 P negative regulation of smoothened signaling pathway involved in dorsal/ventral neural tube patterning
GO:2000059 P negative regulation of ubiquitin-dependent protein catabolic process
RNA-seq EntryA_BomoASG_c29608_g1_i2
Sequence
(Amino Acid)
CQTFTFGLSDLHGDGRVHPPPDRAALSAGAPLPSGCGIELTFRLAADGAEHPPLWPAALL
QALARYVFTTGNKLCAGDHISWHRPLDGERSGGRMRHLLVATEPQLRHARTPHGIVTFLQ
MVGCTSRELRAAQRSSVCEVLKLIAQDPRCGGCWLVTRMERRVSVRAG
(55 a.a.)

- SilkBase 1999-2023 -