SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG16761_5prime_partial:A_BomoASG_c29590_g1_i1
Scaffold_idBomo_Chr21
NCBI non-redundant
(nr)		protein_pygopus_[Bombyx_mori]
Ontology
GO:0001105 F transcription coactivator activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0007223 P Wnt signaling pathway, calcium modulating pathway
GO:0007275 P multicellular organism development
GO:0007367 P segment polarity determination
GO:0007472 P wing disc morphogenesis
GO:0008270 F zinc ion binding
GO:0009880 P embryonic pattern specification
GO:0016055 P Wnt signaling pathway
GO:0022008 P neurogenesis
GO:0030177 P positive regulation of Wnt signaling pathway
GO:0035214 P eye-antennal disc development
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0048526 P imaginal disc-derived wing expansion
GO:0048813 P dendrite morphogenesis
GO:0060232 P delamination
RNA-seq EntryA_BomoASG_c29590_g1_i1
Sequence
(Amino Acid)
IGRASMGQGMGMFGPKPMPVSAGKVYPPDQPMVFNPQNPNAPPIYPCGVCHKEVHDNDQA
ILCESGCNFWFHRGCTGLSEPAFQLLTAEVYAEWVCDKCLSSKNIPLVKFKP
*(36 a.a.)

- SilkBase 1999-2023 -