SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG16576_5prime_partial:A_BomoASG_c29509_g1_i1
Scaffold_idBomo_Chr22
NCBI non-redundant
(nr)		transcription_factor_cwo_isoform_X4_[Bombyx_mori]
Ontology
GO:0001568 P blood vessel development
GO:0001570 P vasculogenesis
GO:0003677 F DNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007219 P Notch signaling pathway
GO:0007275 P multicellular organism development
GO:0007507 P heart development
GO:0035912 P dorsal aorta morphogenesis
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046983 F protein dimerization activity
GO:0048514 P blood vessel morphogenesis
GO:0048844 P artery morphogenesis
GO:0060840 P artery development
GO:0060853 P Notch signaling pathway involved in arterial endothelial cell fate commitment
RNA-seq EntryA_BomoASG_c29509_g1_i1
Sequence
(Amino Acid)
EQLSFAAPSEDEAEYPPGSYLKKGKVSRQDPMSHRIIEKRRRDRMNNCLADLSRLIPPEY
LKKGRGRVEKTEIIEMAIRHLKYLQERVNGLYSENRFVVRNCCRSLQSN
*(35 a.a.)

- SilkBase 1999-2023 -