SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG16541_complete:A_BomoASG_c29491_g1_i2
Scaffold_idBomo_Chr6
NCBI non-redundant
(nr)
cyclin-dependent_kinase_2_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0002088 P lens development in camera-type eye
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004693 F cyclin-dependent protein serine/threonine kinase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005815 C microtubule organizing center
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0006281 P DNA repair
GO:0006468 P protein phosphorylation
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0009636 P response to toxic substance
GO:0015030 C Cajal body
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0030332 F cyclin binding
GO:0031100 P animal organ regeneration
GO:0032355 P response to estradiol
GO:0032403 F protein-containing complex binding
GO:0032869 P cellular response to insulin stimulus
GO:0042493 P response to xenobiotic stimulus
GO:0043231 C intracellular membrane-bounded organelle
GO:0045471 P response to ethanol
GO:0046686 P response to cadmium ion
GO:0046872 F metal ion binding
GO:0051301 P cell division
GO:0051321 P meiotic cell cycle
GO:0051591 P response to cAMP
GO:0051602 P response to electrical stimulus
GO:0051726 P regulation of cell cycle
RNA-seq EntryA_BomoASG_c29491_g1_i2
Sequence
(Amino Acid)
MLASSDSKLFLVFEYLNMDLKRLMDLTKGPLPIDLVKSYLRQLLEGVAYCHAQRVLHRDL
KPQNLLIDEEGHIKLADFGLARAFGIPVRAYTHEVVTLWYRAPEILLGAKFYSTAVDVWS
LACIFAEMASGRTLFPGDSEIDQLFRVFRALGTPGEALWPAARRLPDFRAAFPRWPARPA
RTLLPAGLRAHSSAAALFEAMLRYEPETRIPARAALTHPYLADATLVPPPLHP
*(77 a.a.)

- SilkBase 1999-2023 -