SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG1641_internal:A_BomoASG_c10359_g1_i1
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)		PREDICTED:_USP6_N-terminal-like_protein_isoform_X3_[Papilio_xuthus]
Ontology
GO:0005096 F GTPase activator activity
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006886 P intracellular protein transport
GO:0007030 P Golgi organization
GO:0012505 C endomembrane system
GO:0016023 C cytoplasmic vesicle
GO:0017137 F small GTPase binding
GO:0019068 P virion assembly
GO:0031338 P regulation of vesicle fusion
GO:0031410 C cytoplasmic vesicle
GO:0032588 C trans-Golgi network membrane
GO:0035526 P retrograde transport, plasma membrane to Golgi
GO:0048227 P plasma membrane to endosome transport
GO:0090630 P activation of GTPase activity
GO:1902017 P regulation of cilium assembly
GO:1903358 P regulation of Golgi organization
RNA-seq EntryA_BomoASG_c10359_g1_i1
Sequence
(Amino Acid)
LSDKKYAMHGLYIEGFPKLTRFLEHHDKILTKFMPKLKRHFDKFGLDAILYSLKWFFVCF
VERVPFSLCLRVWDIYLLDGERVITAMAYTILKLHRSEE
(32 a.a.)

- SilkBase 1999-2023 -