SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG1630_3prime_partial:A_BomoASG_c10201_g1_i1
Scaffold_idBomo_Chr7
NCBI non-redundant
(nr)		hypothetical_protein_KGM_214852A,_partial_[Danaus_plexippus_plexippus]
Ontology
GO:0001726 C ruffle
GO:0005509 F calcium ion binding
GO:0005544 F calcium-dependent phospholipid binding
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005938 C cell cortex
GO:0006810 P transport
GO:0008289 F lipid binding
GO:0010828 P positive regulation of glucose transmembrane transport
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0030659 C cytoplasmic vesicle membrane
GO:0031340 P positive regulation of vesicle fusion
GO:0031410 C cytoplasmic vesicle
GO:0032587 C ruffle membrane
GO:0032869 P cellular response to insulin stimulus
GO:0038028 P insulin receptor signaling pathway via phosphatidylinositol 3-kinase
GO:0042995 C cell projection
GO:0065002 P intracellular protein transmembrane transport
GO:0090314 P positive regulation of protein targeting to membrane
RNA-seq EntryA_BomoASG_c10201_g1_i1
Sequence
(Amino Acid)
MPGKIKVKVLAGRNLPVMDRASDTTDAFVEIKFGGVTHKTDVCRKSLNPHWNNTEWYRFE
VDESELQDEPLQLRLMDHDTYSANDAIGKVVISLAPLLAREANNPKS
(34 a.a.)

- SilkBase 1999-2023 -