SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG16209_3prime_partial:A_BomoASG_c29374_g1_i3
Scaffold_idBomo_Chr19
NCBI non-redundant
(nr)
E3_ubiquitin-protein_ligase_Nedd-4_isoform_X3_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000209 P protein polyubiquitination
GO:0003254 P regulation of membrane depolarization
GO:0004842 F ubiquitin-protein transferase activity
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006513 P protein monoubiquitination
GO:0006814 P sodium ion transport
GO:0006883 P cellular sodium ion homeostasis
GO:0007588 P excretion
GO:0010038 P response to metal ion
GO:0015459 F potassium channel regulator activity
GO:0016032 P viral process
GO:0016567 P protein ubiquitination
GO:0016874 F ligase activity
GO:0017080 F sodium channel regulator activity
GO:0019058 P viral life cycle
GO:0019870 F potassium channel inhibitor activity
GO:0019871 F sodium channel inhibitor activity
GO:0030104 P water homeostasis
GO:0030154 P cell differentiation
GO:0034220 P ion transmembrane transport
GO:0034765 P regulation of ion transmembrane transport
GO:0042176 P regulation of protein catabolic process
GO:0042391 P regulation of membrane potential
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0043161 P proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0044325 F transmembrane transporter binding
GO:0045732 P positive regulation of protein catabolic process
GO:0045807 P positive regulation of endocytosis
GO:0060306 P regulation of membrane repolarization
GO:0070062 C extracellular exosome
GO:0070936 P protein K48-linked ubiquitination
GO:0086005 P ventricular cardiac muscle cell action potential
GO:1901016 P regulation of potassium ion transmembrane transporter activity
GO:1901017 P negative regulation of potassium ion transmembrane transporter activity
GO:1901380 P negative regulation of potassium ion transmembrane transport
GO:1902306 P negative regulation of sodium ion transmembrane transport
GO:1903861 P positive regulation of dendrite extension
GO:2000009 P negative regulation of protein localization to cell surface
GO:2000650 P negative regulation of sodium ion transmembrane transporter activity
GO:2001288 P positive regulation of caveolin-mediated endocytosis
RNA-seq EntryA_BomoASG_c29374_g1_i3
Sequence
(Amino Acid)
MLDSRTVAVMHNARPLDVAETGERHRNRSSSWTSRRWQNGLFRQEPRYSLQCQTDENSFL
LRLKIIGANSLAKKDIFGASDPYVRVELQKVDGDVTIETFLTKTKKKTLNPVWNQEFIFR
VKPQEHKLLIQVFDENRLTRDDFLGMVEVPLGSVPAESAASARPNVVKYPLRPRRSVARS
RVRGYIEVYHALVGRVGDPATDEAANRTADDWEMVEPINQVGTVQPTIGGDALPPGWEER
QDANGRTYYVNHIERTTQWERPTFTRHMSVESQAERIENAATEFQRRFHISADEERASSP
APAPQQGDVNSTNSEVTSAEETPFATPDRSPELRRNENEPEPRIATNISVTDCDNIDSSL
SNNDTREDDDVVCANEISRDEAVNETVNTEADETERDGNNTNAQDDADDNDQASQDTVDN
GNVLQQTENNGNDLNDETTNEARSEQPVIEDTLTFDENHFSTPTGGVSPERSPRTRRRRT
TTSSMEDSEDETDGSTESTRSSASSSQSQNLPSSEGLPPGWSMQRAPNGRIFFIDHNKKT
TTWIDPRTGCASSLPSAEAG
(185 a.a.)

- SilkBase 1999-2023 -