SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG15744_internal:A_BomoASG_c29200_g2_i1
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)
PREDICTED:_serine/threonine-protein_kinase_OSR1-like_[Amyelois_transitella]
Ontology
GO:0000166 F nucleotide binding
GO:0001933 P negative regulation of protein phosphorylation
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004702 F obsolete signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0006468 P protein phosphorylation
GO:0006950 P response to stress
GO:0008217 P regulation of blood pressure
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016323 C basolateral plasma membrane
GO:0016324 C apical plasma membrane
GO:0016740 F transferase activity
GO:0018105 P peptidyl-serine phosphorylation
GO:0018107 P peptidyl-threonine phosphorylation
GO:0019901 F protein kinase binding
GO:0023014 P signal transduction
GO:0035556 P intracellular signal transduction
GO:0043268 P positive regulation of potassium ion transport
GO:0050727 P regulation of inflammatory response
GO:0071476 P cellular hypotonic response
GO:0090188 P negative regulation of pancreatic juice secretion
GO:1901017 P negative regulation of potassium ion transmembrane transporter activity
GO:1901380 P negative regulation of potassium ion transmembrane transport
GO:2000021 P ion homeostasis
GO:2000681 P obsolete negative regulation of rubidium ion transport
GO:2000687 P obsolete negative regulation of rubidium ion transmembrane transporter activity
RNA-seq EntryA_BomoASG_c29200_g2_i1
Sequence
(Amino Acid)
HYTRNPQSVQPQPQSTQLQPQSAQPQLQLAQSNPQSTQPKPPPVQPKPQPTQSQSQPEQP
PKAQPVIMKIVPTVVNLVLRLRNSRGELNDIRFEYVIGKDTAEGIASELVGAGLIDPNDS
VPISSNLAKLLNGHVAAMQTAPKAITFHLNSSRPNQTY
(51 a.a.)

- SilkBase 1999-2023 -