SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG1573_internal:A_BomoASG_c9648_g1_i1
Scaffold_idBomo_Chr8
NCBI non-redundant
(nr)		leucine-rich_repeat_G_protein-coupled_receptor_isoform_X3_[Bombyx_mori]
Ontology
GO:0004871 F obsolete signal transducer activity
GO:0004930 F G protein-coupled receptor activity
GO:0004996 F thyroid-stimulating hormone receptor activity
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0007165 P signal transduction
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007189 P adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007190 P activation of adenylate cyclase activity
GO:0007399 P nervous system development
GO:0008528 F G protein-coupled peptide receptor activity
GO:0009755 P hormone-mediated signaling pathway
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016500 F protein-hormone receptor activity
GO:0038194 P thyroid-stimulating hormone signaling pathway
RNA-seq EntryA_BomoASG_c9648_g1_i1
Sequence
(Amino Acid)
GNVAVLLVLLTNHTELTVPRFLMCNLAFSDLCTGLYLLMLAVVDLRSYGEFFNYAYNWQY
GVGCKIAGFLSVFSGQLSVITLTIVTLERWFAITYAIYLERRISLSTAAKIMLGGWL
(38 a.a.)

- SilkBase 1999-2023 -