SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG15300_internal:A_BomoASG_c29013_g1_i1
Scaffold_idBomo_Chr8
NCBI non-redundant
(nr)
LOW_QUALITY_PROTEIN:_huntingtin-interacting_protein_1_[Bombyx_mori]
Ontology
GO:0003779 F actin binding
GO:0005200 F structural constituent of cytoskeleton
GO:0005515 F protein binding
GO:0005543 F phospholipid binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005856 C cytoskeleton
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006897 P endocytosis
GO:0006915 P apoptotic process
GO:0006919 P activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0012505 C endomembrane system
GO:0016020 C membrane
GO:0030136 C clathrin-coated vesicle
GO:0030154 P cell differentiation
GO:0030276 F clathrin binding
GO:0030665 C clathrin-coated vesicle membrane
GO:0031410 C cytoplasmic vesicle
GO:0035091 F phosphatidylinositol binding
GO:0042981 P regulation of apoptotic process
GO:0043231 C intracellular membrane-bounded organelle
GO:0048260 P positive regulation of receptor-mediated endocytosis
GO:0048268 P clathrin coat assembly
GO:0072583 P clathrin-dependent endocytosis
GO:0097190 P apoptotic signaling pathway
RNA-seq EntryA_BomoASG_c29013_g1_i1
Sequence
(Amino Acid)
CSSDLLEVNGKILDACTTLMAAVKVLVQDARQLQNELGDQHSRQKMYRKNPQWSEGLISA
AKAVVFAAKLLVSSADEAVGGSGRMEGVSAAAHEVAGSTAQLVA
(33 a.a.)

- SilkBase 1999-2023 -