SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG15206_internal:A_BomoASG_c28976_g3_i1
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)		PREDICTED:_agrin-like_isoform_X6_[Papilio_polytes]
Ontology
GO:0002162 F dystroglycan binding
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005578 C extracellular matrix
GO:0005605 C basement membrane
GO:0005886 C plasma membrane
GO:0007171 P activation of transmembrane receptor protein tyrosine kinase activity
GO:0007213 P G protein-coupled acetylcholine receptor signaling pathway
GO:0007275 P multicellular organism development
GO:0008201 F heparin binding
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030054 C cell junction
GO:0030154 P cell differentiation
GO:0030198 P extracellular matrix organization
GO:0030297 F transmembrane receptor protein tyrosine kinase activator activity
GO:0030548 F acetylcholine receptor regulator activity
GO:0033691 F sialic acid binding
GO:0035374 F chondroitin sulfate binding
GO:0043113 P receptor clustering
GO:0043236 F laminin binding
GO:0043395 F heparan sulfate proteoglycan binding
GO:0043547 P positive regulation of GTPase activity
GO:0045202 C synapse
GO:0045887 P positive regulation of synaptic assembly at neuromuscular junction
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0051491 P positive regulation of filopodium assembly
GO:0099601 P regulation of neurotransmitter receptor activity
RNA-seq EntryA_BomoASG_c28976_g3_i1
Sequence
(Amino Acid)
KGDCALCDGVQCSFGASCAAGECICPTDCTGSAREPVCGSSMQTYPNECELQKAACRLPP
PGTLHVIFYGDCKDRLAVVPPIAMSMEVRPCGNNKAMLDPTTGLEIDCGNGPHRQDCPAG
SYCHITLTAARCCPKNDSKVADEKKSHCSESTYGCCSDGSTPATGPHEEGCVPSTSCGCN
RLGS
(60 a.a.)

- SilkBase 1999-2023 -