SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG15201_internal:A_BomoASG_c28976_g1_i1
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)
agrin_isoform_X2_[Bombyx_mori]
Ontology
GO:0001523 P retinoid metabolic process
GO:0002162 F dystroglycan binding
GO:0005200 F structural constituent of cytoskeleton
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005578 C extracellular matrix
GO:0005605 C basement membrane
GO:0005737 C cytoplasm
GO:0005796 C Golgi lumen
GO:0005886 C plasma membrane
GO:0006024 P glycosaminoglycan biosynthetic process
GO:0006027 P glycosaminoglycan catabolic process
GO:0007165 P signal transduction
GO:0007213 P G protein-coupled acetylcholine receptor signaling pathway
GO:0007275 P multicellular organism development
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030054 C cell junction
GO:0030154 P cell differentiation
GO:0030198 P extracellular matrix organization
GO:0030203 P glycosaminoglycan metabolic process
GO:0031012 C extracellular matrix
GO:0033691 F sialic acid binding
GO:0035374 F chondroitin sulfate binding
GO:0043113 P receptor clustering
GO:0043202 C lysosomal lumen
GO:0043236 F laminin binding
GO:0043395 F heparan sulfate proteoglycan binding
GO:0043547 P positive regulation of GTPase activity
GO:0045162 P clustering of voltage-gated sodium channels
GO:0045202 C synapse
GO:0045887 P positive regulation of synaptic assembly at neuromuscular junction
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0050808 P synapse organization
GO:0051491 P positive regulation of filopodium assembly
GO:0070062 C extracellular exosome
RNA-seq EntryA_BomoASG_c28976_g1_i1
Sequence
(Amino Acid)
GRLHIKHMGSCESCTGVQCPSGTWCGRGACSCAAPCAGSAREPVCSSAGRTYPHECALLK
AACEARMRAEPQLRVAYYGECTDSVDNTTAGLNKTGALSELTNEIRSEDTTENANEGGSN
AVCARVQCAYEATCAVDSNGQPRCACLFDCAAAAAASTSSPVCASDLRLYPTLCHMKLEA
CRRQEDLRLRPLALCRGLEFRPCGDDEPLTDKEGRPYDCGGGPHRKDCPMGSYCHHTAKA
ARCCRKDKGVTEKKGCQDTWHGCCADGVTAARGPGGAGCPSQCGCHRLGSVREQCDESGQ
CSCRAGVGGLKRDRCEPGRSE
(106 a.a.)

- SilkBase 1999-2023 -