SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG15195_5prime_partial:A_BomoASG_c28973_g1_i2
Scaffold_idBomo_Chr9
NCBI non-redundant
(nr)		protoporphyrinogen_oxidase_[Bombyx_mori]
Ontology
GO:0004729 F oxygen-dependent protoporphyrinogen oxidase activity
GO:0005739 C mitochondrion
GO:0005743 C mitochondrial inner membrane
GO:0005758 C mitochondrial intermembrane space
GO:0006779 P porphyrin-containing compound biosynthetic process
GO:0006782 P protoporphyrinogen IX biosynthetic process
GO:0006783 P heme biosynthetic process
GO:0016020 C membrane
GO:0016491 F oxidoreductase activity
GO:0031304 C intrinsic component of mitochondrial inner membrane
GO:0031305 C integral component of mitochondrial inner membrane
GO:0031966 C mitochondrial membrane
GO:0042493 P response to xenobiotic stimulus
GO:0046501 P protoporphyrinogen IX metabolic process
GO:0050660 F flavin adenine dinucleotide binding
GO:0055114 P obsolete oxidation-reduction process
RNA-seq EntryA_BomoASG_c28973_g1_i2
Sequence
(Amino Acid)
IGRALLGGRWFEEKFGKNTTSENLYNIAVKEVGSILDIKDKPTAFNVNILNRCIPQYVVG
HYERVDEIRQYIKSNNLPISLIGSSYDGVGINDVIYSAKSQVEET
*(34 a.a.)

- SilkBase 1999-2023 -