SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG15098_internal:A_BomoASG_c28932_g1_i2
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)		zinc_finger_protein_98_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000980 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001206 F DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0001501 P skeletal system development
GO:0001823 P mesonephros development
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003690 F double-stranded DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005730 C nucleolus
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006915 P apoptotic process
GO:0007417 P central nervous system development
GO:0008022 F protein C-terminus binding
GO:0008285 P negative regulation of cell population proliferation
GO:0009880 P embryonic pattern specification
GO:0009952 P anterior/posterior pattern specification
GO:0016567 P protein ubiquitination
GO:0016604 C nuclear body
GO:0016605 C PML body
GO:0016607 C nuclear speck
GO:0017053 C transcription repressor complex
GO:0019904 F protein domain specific binding
GO:0030097 P hemopoiesis
GO:0030099 P myeloid cell differentiation
GO:0032332 P positive regulation of chondrocyte differentiation
GO:0034504 P protein localization to nucleus
GO:0035116 P embryonic hindlimb morphogenesis
GO:0035136 P forelimb morphogenesis
GO:0035137 P hindlimb morphogenesis
GO:0042733 P embryonic digit morphogenesis
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0043065 P positive regulation of apoptotic process
GO:0045600 P positive regulation of fat cell differentiation
GO:0045638 P negative regulation of myeloid cell differentiation
GO:0045778 P positive regulation of ossification
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
GO:0048133 P male germ-line stem cell asymmetric division
GO:0051138 P positive regulation of NK T cell differentiation
GO:0051216 P cartilage development
GO:0061036 P positive regulation of cartilage development
RNA-seq EntryA_BomoASG_c28932_g1_i2
Sequence
(Amino Acid)
DDDDDDDDDVSVHFNNLEEDSEDEPLVKCKRKRKVQVKKNCTTAKHTPNSKKFEGSWKCE
LCGETGDKGGTNAEEAHRLSVHSGMNSGNNGAFNDVKTEDSADGSESPFKYTFKESLLLA
LGNLDESSKGDEKIKKKKTKATRKKKKVLKDTKTKVMHQCDQCTNRYTSLVRLERHKQIK
HEGSKPPYICEICGAHYKHKRACDIHIALHKGISDWKCEECNKLFPSKNALQRHNNIHTG
KLNYQVSNG
(82 a.a.)

- SilkBase 1999-2023 -