SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoASG14963_complete:A_BomoASG_c28873_g1_i3
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)		aprataxin_and_PNK-like_factor_isoform_X4_[Bombyx_mori]
Ontology
GO:0000012 P single strand break repair
GO:0000166 F nucleotide binding
GO:0003906 F DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0004520 F endodeoxyribonuclease activity
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006281 P DNA repair
GO:0006302 P double-strand break repair
GO:0006974 P cellular response to DNA damage stimulus
GO:0008408 F 3'-5' exonuclease activity
GO:0016829 F lyase activity
GO:0035861 C site of double-strand break
GO:0045191 P regulation of isotype switching
GO:0046872 F metal ion binding
GO:0051106 P positive regulation of DNA ligation
GO:0090305 P nucleic acid phosphodiester bond hydrolysis
RNA-seq EntryA_BomoASG_c28873_g1_i3
Sequence
(Amino Acid)
MYGANCYRRNPQHAALYSHPRDADWTPAPRCRYGERCTRRDPRHRRDYLHPAPAPAPADP
PGMQLVQRHGNTFYINAHTVNFYDDHFQVEDSDGDSVDYDYEF
*(33 a.a.)

- SilkBase 1999-2023 -