SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoASG14746_complete:A_BomoASG_c28784_g1_i1
Scaffold_idBomo_Chr16
NCBI non-redundant
(nr)
cell_division_cycle_2_[Bombyx_mori]
Ontology
GO:0000082 P G1/S transition of mitotic cell cycle
GO:0000086 P G2/M transition of mitotic cell cycle
GO:0000166 F nucleotide binding
GO:0000278 P mitotic cell cycle
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004693 F cyclin-dependent protein serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005875 C microtubule associated complex
GO:0006468 P protein phosphorylation
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0007095 P mitotic G2 DNA damage checkpoint signaling
GO:0007140 P male meiotic nuclear division
GO:0007141 P male meiosis I
GO:0007283 P spermatogenesis
GO:0007284 P spermatogonial cell division
GO:0008315 P G2/MI transition of meiotic cell cycle
GO:0008353 F RNA polymerase II CTD heptapeptide repeat kinase activity
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0022008 P neurogenesis
GO:0030707 P ovarian follicle cell development
GO:0032880 P regulation of protein localization
GO:0044818 P mitotic G2/M transition checkpoint
GO:0048142 P germarium-derived cystoblast division
GO:0051301 P cell division
GO:0051726 P regulation of cell cycle
GO:0055059 P asymmetric neuroblast division
GO:0070816 P phosphorylation of RNA polymerase II C-terminal domain
RNA-seq EntryA_BomoASG_c28784_g1_i1
Sequence
(Amino Acid)
MDDFLKIEKIGEGTYGVVYKGKNKITGQFVAMKKIRLESEDEGIPSTAIREISLLKELNH
PNIVKLEDVLMEESRLYLIFEFLSMDLKKYMDSLGSGKFMDPSVVKSYLYQINNAILYCH
QRRILHRDLKPQNLLIDKTGIIKVADFGLGRAFGVPVRVYTHEVVTLWYRAPEVLLGSQR
YSCPIDIWSVGCIFSEMSSKKPLFQGDSEIDQLFRIFRMLRTPTEEIWPGVSLLPDYKPT
FPNWNTYNLHNHVQNLDEVGMDLLQKMLVYDPVKRISAKDARRHKYFRDVKLPPGLTVHD
AYIRVTPEYPYDTDSVQSV
*(105 a.a.)

- SilkBase 1999-2023 -